Property Summary

NCBI Gene PubMed Count 17
PubMed Score 36.04
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.300 1.7e-02
hepatocellular carcinoma 1.700 2.3e-05
pancreatic cancer 1.800 1.7e-03
osteosarcoma -3.228 3.7e-03
chronic lymphosyte leukemia -1.100 8.7e-07
non-small cell lung cancer -1.728 1.3e-18
intraductal papillary-mucinous carcinoma... -1.200 1.5e-02
interstitial cystitis 1.800 3.2e-05
pediatric high grade glioma 1.100 9.4e-03
pilocytic astrocytoma 1.900 8.3e-07
pancreatic carcinoma 1.800 1.7e-03
lung adenocarcinoma -1.800 1.8e-10
lung carcinoma -1.300 6.3e-13
spina bifida -1.062 4.9e-02
mucosa-associated lymphoid tissue lympho... 1.105 1.8e-02
ulcerative colitis 1.700 4.0e-04
ovarian cancer -2.100 2.4e-09

Synonym

Accession Q9NS28 B2RD23 RGS18
Symbols RGS13

Gene

PANTHER Protein Class (2)

PDB

2DLV   2JM5   2OWI  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
22234696 These findings indicate cross-talk between platelet activation and inhibition pathways at the level of RGS18 and Gq.
22210881 Data show that that SPL/RGS/SHP1 complexes are present in resting platelets where constitutive phosphorylation of SPL(Y398) creates an atypical binding site for SHP-1.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16484797 gene mapped to chromosome 1.
11955952 molecular cloning and characterization of RGS18 as a regulator of G protein signalling in human platelets

AA Sequence

METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLA      1 - 70
KETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYE     71 - 140
KFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPT    141 - 210
NLRRRSRSFTCNEFQDVQSDVAIWL                                                 211 - 235
//

Text Mined References (18)

PMID Year Title
22234696 2012 Regulator of G-protein signaling 18 integrates activating and inhibitory signaling in platelets.
22210881 2012 A newly identified complex of spinophilin and the tyrosine phosphatase, SHP-1, modulates platelet activation by regulating G protein-dependent signaling.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16484797 2006 Assignment of UCK2, ATF3 and RGS18 from human chromosome 1 to porcine chromosomes 4, 9 and 10 with somatic and radiation hybrid panels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14992813 2004 Selective expression of regulators of G-protein signaling (RGS) in the human central nervous system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645010 2004 Differential proteome analysis of TRAP-activated platelets: involvement of DOK-2 and phosphorylation of RGS proteins.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11955952 2002 Cloning and characterization of a novel regulator of G protein signalling in human platelets.
11829488 2002 Evolution of the regulators of G-protein signaling multigene family in mouse and human.
11563974 2001 RGS18 is a myeloerythroid lineage-specific regulator of G-protein-signalling molecule highly expressed in megakaryocytes.
11342430 2001 A novel regulator of G-protein signaling bearing GAP activity for Galphai and Galphaq in megakaryocytes.
11042171 2001 Molecular cloning and characterization of a novel regulator of G-protein signaling from mouse hematopoietic stem cells.