Property Summary

NCBI Gene PubMed Count 30
PubMed Score 40.86
PubTator Score 27.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.100 3.6e-02
astrocytic glioma -1.100 8.5e-03
oligodendroglioma -1.200 8.8e-03
psoriasis 2.000 6.2e-05
osteosarcoma -1.817 7.1e-05
glioblastoma -1.500 1.3e-03
medulloblastoma -1.600 1.2e-05
medulloblastoma, large-cell -1.300 3.2e-02
primitive neuroectodermal tumor -1.500 3.2e-03
Atopic dermatitis 1.300 6.6e-05
tuberculosis 1.100 1.3e-03
active ulcerative colitis 1.072 4.6e-02
adult high grade glioma -1.100 2.9e-03
pilocytic astrocytoma -1.300 2.7e-06

Gene RIF (7)

PMID Text
23255434 The RBD region associates with the RGS domain region, producing an intramolecular interaction within RGS14 that enhances the GTPase activating function.
21880739 RGS14 can form complexes with GPCRs in cells that are dependent on Galpha(i/o) and these RGS14.Galpha(i1).GPCR complexes may be substrates for other signaling partners such as Ric-8A
20842066 RGS-14 may facilitate cognitive processing by modulating Cav1 channel-mediated intracellular divalent calcium ion Ca(2)+ transients.
20627871 Observational study of gene-disease association. (HuGE Navigator)
19878719 RGS14 serves as a novel scaffold to integrate GTP-Binding Protein alpha Subunit and Ras/Raf/MAPkinase signalling events through the action of its GL domain.
19636837 NMR 1H, 13C and 15N resonances of the RGS domain (residues 56-207)
15917656 We show that RGS14 is a component of mitotic asters formed in vitro from HeLa cell extracts and that depletion of RGS14 from cell extracts blocks aster formation.

AA Sequence

MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQPVASWALSFER      1 - 70
LLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSPVNIDRQA     71 - 140
WLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDATRKK    141 - 210
PKLKPGKSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSS    211 - 280
KSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNE    281 - 350
QALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPG    351 - 420
EKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSAT    421 - 490
GKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNS    491 - 560
TTDSAL                                                                    561 - 566
//

Text Mined References (36)

PMID Year Title
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23255434 2013 The Ras-binding domain region of RGS14 regulates its functional interactions with heterotrimeric G proteins.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22396660 2012 A genome-wide association study of nephrolithiasis in the Japanese population identifies novel susceptible Loci at 5q35.3, 7p14.3, and 13q14.1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21880739 2011 G protein-coupled receptors and resistance to inhibitors of cholinesterase-8A (Ric-8A) both regulate the regulator of g protein signaling 14 RGS14·G?i1 complex in live cells.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21115486 2011 Structural determinants of affinity enhancement between GoLoco motifs and G-protein alpha subunit mutants.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20842066 2010 Regulator of G-protein signaling 14 protein modulates Ca²+ influx through Cav1 channels.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
19878719 2010 RGS14 is a multifunctional scaffold that integrates G protein and Ras/Raf MAPkinase signalling pathways.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19636837 2007 Backbone and sidechain 1H, 13C and 15N resonance assignments of the RGS domain from human RGS14.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17635935 2007 Localization of Gi alpha proteins in the centrosomes and at the midbody: implication for their role in cell division.
17603074 2007 Structure-based protocol for identifying mutations that enhance protein-protein binding affinities.
16819986 2006 Localization of the GoLoco motif carrier regulator of G-protein signalling 12 and 14 proteins in monkey and rat brain.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15917656 2005 RGS14 is a microtubule-associated protein.
15525537 2004 RGS14 is a mitotic spindle protein essential from the first division of the mammalian zygote.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12534294 2003 Phosphorylation of RGS14 by protein kinase A potentiates its activity toward G alpha i.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11976690 2002 Structural determinants for GoLoco-induced inhibition of nucleotide release by Galpha subunits.
11829488 2002 Evolution of the regulators of G-protein signaling multigene family in mouse and human.
11387333 2001 RGS12 and RGS14 GoLoco motifs are G alpha(i) interaction sites with guanine nucleotide dissociation inhibitor Activity.
10953050 2000 RGS14, a GTPase-activating protein for Gialpha, attenuates Gialpha- and G13alpha-mediated signaling pathways.
10926822 2000 RGS14 is a novel Rap effector that preferentially regulates the GTPase activity of galphao.
9168931 1997 Molecular cloning and expression analysis of rat Rgs12 and Rgs14.