Property Summary

NCBI Gene PubMed Count 31
PubMed Score 43.94
PubTator Score 27.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis 1.072 4.6e-02
adult high grade glioma -1.100 2.9e-03
astrocytic glioma -1.100 8.5e-03
Astrocytoma, Pilocytic -1.200 6.3e-06
Atopic dermatitis 1.300 6.6e-05
glioblastoma -1.100 5.5e-04
group 4 medulloblastoma -1.200 8.0e-04
medulloblastoma, large-cell -1.200 2.3e-03
oligodendroglioma -1.200 8.8e-03
osteosarcoma -1.817 7.1e-05
primitive neuroectodermal tumor -1.300 9.3e-04
psoriasis 2.000 6.2e-05
Rheumatoid arthritis -1.100 3.6e-02
tuberculosis 1.100 1.3e-03

Gene RIF (8)

AA Sequence

MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQPVASWALSFER      1 - 70
LLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSPVNIDRQA     71 - 140
WLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDATRKK    141 - 210
PKLKPGKSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSS    211 - 280
KSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNE    281 - 350
QALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPG    351 - 420
EKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSAT    421 - 490
GKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNS    491 - 560
TTDSAL                                                                    561 - 566
//

Text Mined References (37)

PMID Year Title