Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.63
PubTator Score 4.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis -1.800 1.1e-03
head and neck cancer -1.800 2.9e-02
nasopharyngeal carcinoma -1.800 3.0e-02
non-small cell lung cancer -2.690 4.9e-29
pancreatic cancer 1.400 4.7e-02
pancreatic carcinoma 1.400 4.7e-02
primary Sjogren syndrome 1.200 1.4e-02
psoriasis -1.100 4.4e-04
tuberculosis -1.300 8.1e-04

Synonym

Accession O14921 Q6PGR2 Q8TD63 Q9BX45 RGS13
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETY      1 - 70
KKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRF     71 - 140
LKSEMYQKLLKTMQSNNSF                                                       141 - 159
//

Text Mined References (13)

PMID Year Title