Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.54
PubTator Score 14.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group A ependymoma -1.300 1.0e-07
oligodendroglioma 1.200 2.0e-03
psoriasis 1.800 2.0e-04
osteosarcoma -1.517 3.1e-05
atypical teratoid / rhabdoid tumor -1.200 5.1e-04
glioblastoma -1.300 1.6e-06
medulloblastoma 1.200 3.6e-03
medulloblastoma, large-cell -1.400 1.1e-03
pediatric high grade glioma -1.100 2.2e-05
non primary Sjogren syndrome sicca -1.200 2.5e-02

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
879 confirmatory 12 / 20 / 1247 qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Green Fluorophore)
880 confirmatory 1029 / 0 / 233132 qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Red Fluorophore)
2390 confirmatory 59 / 29 / 24 Confirmation qHTS Assay for Inhibitors of RGS12 GoLoco Motif Activity (Red Fluorophore)
2406 summary 0 / 0 / 0 Probe Development Summary for Inhibitors of RGS12 GoLoco Motif Activity

Gene RIF (5)

PMID Text
20627871 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
17042716 RGS12 is essential for the terminal differentiation of osteoclasts induced by RANKL.
9168931 shows chromosomal mapping information for human locus.

AA Sequence

MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEI      1 - 70
NVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFESCSSDEEGGLYEGKGWLKPKLDSKALGINRAERVVEE     71 - 140
MQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFDVGHESINNPNPNMLSKEEISKVIHDDSVFS    141 - 210
IGLESHDDFALDASILNVAMIVGYLGSIELPSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDC    211 - 280
VQLSTDKAGVVAEYPAEKLAFSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHK    281 - 350
IHQGIARRFGFECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS    351 - 420
NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGAPWTGPFCPDPEGSPPFEAAH    421 - 490
QTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPVHVLREWQCGHTSDQDSYTDS    491 - 560
TDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKREWSRKAFGMQSIFGPHRNVRKTKEDKKGSK    561 - 630
FGRGTGLTQPSQRTSARRSFGRSKRFSITRSLDDLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQS    631 - 700
CRRLRERRVASWAVSFERLLQDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIF    701 - 770
SKFLCSKATTPVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA    771 - 840
LPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQ    841 - 910
KKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIHLPDGTSCVVAVKA    911 - 980
GFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLDLVPINRSVGLKA    981 - 1050
KPTKPVTEVLRPVVARYGLDLSGLLVRLSGEKEPLDLGAPISSLDGQRVVLEEKDPSRGKASADKQKGVP   1051 - 1120
VKQNTAVNSSSRNHSATGEERTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEF   1121 - 1190
FELISKAQSNRADDQRGLLRKEDLVLPEFLRLPPGSTELTLPTPAAVAKGFSKRSATGNGRESASQPGEQ   1191 - 1260
WEPVQESSDSPSTSPGSASSPPGPPGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQSQEVEAGGIQ   1261 - 1330
TVEDEHVAELTLMGEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRDLPVNRIIDVDLVTGSAPGRD   1331 - 1400
GGIAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTSAHHATFV                          1401 - 1447
//

Text Mined References (25)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17042716 2007 RGS12 is essential for RANKL-evoked signaling for terminal differentiation of osteoclasts in vitro.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461749 2003 Identification of novel genes with somatic frameshift mutations within coding mononucleotide repeats in colorectal tumors with high microsatellite instability.
12024043 2002 RGS12TS-S localizes at nuclear matrix-associated subnuclear structures and represses transcription: structural requirements for subnuclear targeting and transcriptional repression.
11829488 2002 Evolution of the regulators of G-protein signaling multigene family in mouse and human.
11771424 2002 Molecular cloning of regulators of G-protein signaling family members and characterization of binding specificity of RGS12 PDZ domain.
11387333 2001 RGS12 and RGS14 GoLoco motifs are G alpha(i) interaction sites with guanine nucleotide dissociation inhibitor Activity.
11130074 2000 Tyrosine-kinase-dependent recruitment of RGS12 to the N-type calcium channel.
10911908 2000 Use of representational difference analysis and cDNA arrays for transcriptional profiling of tumor tissue.
10869340 2000 Novel alternative splicing and nuclear localization of human RGS12 gene products.
9651375 1998 GTPase activating specificity of RGS12 and binding specificity of an alternatively spliced PDZ (PSD-95/Dlg/ZO-1) domain.
9168931 1997 Molecular cloning and expression analysis of rat Rgs12 and Rgs14.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.