Property Summary

NCBI Gene PubMed Count 18
PubMed Score 46.88
PubTator Score 9.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease -1.352 6.0e-03
adult high grade glioma -2.100 4.8e-04
Astrocytoma, Pilocytic -1.100 4.1e-03
atypical teratoid / rhabdoid tumor -1.400 1.0e-02
Breast cancer 1.500 2.7e-05
ependymoma -1.500 1.4e-04
glioblastoma -1.600 3.1e-04
group 3 medulloblastoma -1.700 8.1e-03
lung carcinoma 1.600 8.1e-24
malignant mesothelioma -2.100 2.9e-06
medulloblastoma, large-cell -2.500 1.7e-03
Pick disease -1.900 1.6e-05
progressive supranuclear palsy -1.300 2.9e-02

Gene RIF (6)

AA Sequence

MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEE      1 - 70
EALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAELDYAIYLAKKNIRKRGTLVD     71 - 140
YEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRLVIACQEQTYWLVNRPPPGAPDVLEQGPGRG    141 - 210
SCAASRVLMTKSADFHKREIEYFRKALGRTRVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDA    211 - 280
YWVMNAPTVAAPTKLRVERWGFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTL    281 - 350
VDAVYEQFLAPGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE    351 - 420
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA                           421 - 467
//

Text Mined References (18)

PMID Year Title