Property Summary

NCBI Gene PubMed Count 43
PubMed Score 97.81
PubTator Score 54.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
hepatocellular carcinoma -1.100 5.0e-02
Multiple myeloma -1.023 2.8e-02
urothelial carcinoma -3.800 1.1e-03
esophageal adenocarcinoma 1.900 3.9e-02
psoriasis -4.300 3.2e-11
cutaneous lupus erythematosus 3.700 1.9e-03
astrocytoma 2.300 6.2e-13
glioblastoma 3.000 9.5e-03
oligodendroglioma 1.600 1.1e-05
periodontitis 1.800 2.5e-19
medulloblastoma, large-cell -1.600 6.3e-03
Atopic dermatitis 2.700 5.8e-05
tuberculosis -3.700 2.3e-06
intraductal papillary-mucinous carcinoma... -1.500 3.3e-02
lung cancer -2.900 2.8e-05
pancreatic cancer 1.100 3.0e-02
breast carcinoma 1.500 7.3e-03
adult high grade glioma 1.900 9.3e-04
group 4 medulloblastoma -1.600 1.1e-03
pilocytic astrocytoma 1.700 5.0e-03
posterior fossa group A ependymoma 1.800 1.7e-05
primary Sjogren syndrome 2.100 1.8e-04
invasive ductal carcinoma 3.900 1.2e-04
inflammatory breast cancer -2.300 6.2e-05
lung carcinoma -2.100 3.6e-09
non-small cell lung carcinoma 1.200 8.5e-12
ductal carcinoma in situ 2.700 3.3e-03
ulcerative colitis 3.700 2.1e-06
ovarian cancer 3.800 3.2e-06
Down syndrome 2.700 1.3e-02

Protein-protein Interaction (1)

Gene RIF (27)

PMID Text
26222051 RGS1 as a potential marker of CRC tissue quality
25897806 RGS1 suppresses CXCL12-mediated migration and AKT activation in cultured human plasmacytoma cells and plasmablasts.
25782711 Rgs1 has a role in leukocyte trafficking and vascular inflammation
24162774 HIV-1 gp120 upregulates the expression of regulator of G-protein signaling 1 (RGS1) in human B cells
24130709 RGS1 and TNFRSF1A polymorphisms tended to be associated with reduced attack severity in Multiple sclerosis.
23898208 HIV-1 gp120 upregulates the expression of regulator of G-protein signaling 1 (RGS1) in human B cells
23464602 RGS1 is largely upregulated, whereas RGS2 is downregulated in the majority of solid tumors, whereas RGS5 transcripts are greatly increased in eight subtypes of lymphoma with no reports of downregulation in hematological malignancies
23324853 Markers in the RGS1 gene might be in linkage disequilibrium with a protective allele that reduces the risk of anxiety and depressive disorders.
21795595 Elevated RGS1 levels profoundly reduce T cell migration to lymphoid-homing chemokines
20647273 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20627871 Observational study of gene-disease association. (HuGE Navigator)
20555355 RGS1 is a novel multiple sclerosis susceptibility loci, shared with celieac disease.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20083228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19879194 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19877080 Undifferentiated spondylarthritis (uSpA) peripheral blood mononuclear cells (PBMCs) carry more expressed genes than PBMCs from ankylosing spondylitis (AS) patients. TNFalpha- and IL-17-inducible RGS1 is a biomarker for uSpA, and to a lesser extent for AS.
19865102 Observational study of gene-disease association. (HuGE Navigator)
19693089 Observational study of gene-disease association. (HuGE Navigator)
19073967 Observational study of gene-disease association. (HuGE Navigator)
18805825 Observational study of gene-disease association. (HuGE Navigator)
18580492 Results validate the role of RGS1 as a novel prognostic marker for melanoma given its impact on the survival associated with melanoma.
18311140 Genome-wide association study of gene-disease association. (HuGE Navigator)
18301890 RGS1 is (over-) expressed in a broad variety of malignancies
16565322 RGS1 and RGS13 act together to regulate chemokine receptor signaling in human germinal center B lymphocytes and contribute significantly to the rapid desensitization of the signaling pathway.
15728464 Overexpression of RGS1 in progenitor pro-B cells (which have little endogenous RGS1) impairs CXCL12-induced focal adhesion kinase activation, chemotaxis, and adhesion to membrane domains.

AA Sequence

MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKS      1 - 70
KDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF     71 - 140
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQANSLK     141 - 209
//

Text Mined References (42)

PMID Year Title
26222051 2015 Identification and Validation of a Potential Marker of Tissue Quality Using Gene Expression Analysis of Human Colorectal Tissue.
25897806 2015 Regulator of G protein signaling 1 suppresses CXCL12-mediated migration and AKT activation in RPMI 8226 human plasmacytoma cells and plasmablasts.
25782711 2015 RGS1 regulates myeloid cell accumulation in atherosclerosis and aortic aneurysm rupture through altered chemokine signalling.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
23464602 2013 RGS expression in cancer: oncomining the cancer microarray data.
23324853 2013 Genetic association between RGS1 and internalizing disorders.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21795595 2011 Cutting Edge: Regulator of G protein signaling-1 selectively regulates gut T cell trafficking and colitic potential.
20647273 2010 Investigation of type 1 diabetes and coeliac disease susceptibility loci for association with juvenile idiopathic arthritis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20555355 2010 IL12A, MPHOSPH9/CDK2AP1 and RGS1 are novel multiple sclerosis susceptibility loci.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20083228 2010 Genome-wide analysis of chromosomal alterations in patients with esophageal squamous cell carcinoma exposed to tobacco and betel quid from high-risk area in India.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19879194 2009 Integration of genetic risk factors into a clinical algorithm for multiple sclerosis susceptibility: a weighted genetic risk score.
19877080 2009 Identification of RGS1 as a candidate biomarker for undifferentiated spondylarthritis by genome-wide expression profiling and real-time polymerase chain reaction.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19693089 2010 Four novel coeliac disease regions replicated in an association study of a Swedish-Norwegian family cohort.
19073967 2008 Shared and distinct genetic variants in type 1 diabetes and celiac disease.
18805825 2009 Six new coeliac disease loci replicated in an Italian population confirm association with coeliac disease.
18580492 2008 Novel role for RGS1 in melanoma progression.
18434541 2008 Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.
18311140 2008 Newly identified genetic risk variants for celiac disease related to the immune response.
18301890 2008 Generation of antigen-specific CTL responses using RGS1 mRNA transfected dendritic cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16565322 2006 RGS1 and RGS13 mRNA silencing in a human B lymphoma line enhances responsiveness to chemoattractants and impairs desensitization.
15728464 2005 CXC chemokine ligand 12-induced focal adhesion kinase activation and segregation into membrane domains is modulated by regulator of G protein signaling 1 in pro-B cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11520900 2001 Differential capacities of the RGS1, RGS16 and RGS-GAIP regulators of G protein signaling to enhance alpha2A-adrenoreceptor agonist-stimulated GTPase activity of G(o1)alpha.
11251075 2001 GIPC and GAIP form a complex with TrkA: a putative link between G protein and receptor tyrosine kinase pathways.
10760272 2000 MIR16, a putative membrane glycerophosphodiester phosphodiesterase, interacts with RGS16.
10747990 2000 Ca2+/Calmodulin reverses phosphatidylinositol 3,4, 5-trisphosphate-dependent inhibition of regulators of G protein-signaling GTPase-activating protein activity.
10480894 1999 RGS1 is expressed in monocytes and acts as a GTPase-activating protein for G-protein-coupled chemoattractant receptors.
9774420 1998 Regulation of chemotactic and proadhesive responses to chemoattractant receptors by RGS (regulator of G-protein signaling) family members.
9174164 1997 Comparison of mRNA expression of two regulators of G-protein signaling, RGS1/BL34/1R20 and RGS2/G0S8, in cultured human blood mononuclear cells.
8602223 1996 Inhibition of G-protein-mediated MAP kinase activation by a new mammalian gene family.
8473738 1993 Isolation and characterization of a novel B cell activation gene.
8241276 1993 A B cell specific immediate early human gene is located on chromosome band 1q31 and encodes an alpha helical basic phosphoprotein.