Property Summary

NCBI Gene PubMed Count 46
PubMed Score 111.57
PubTator Score 54.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (30)

Disease log2 FC p
adult high grade glioma 1.800 5.3e-03
astrocytoma 2.200 5.2e-11
Astrocytoma, Pilocytic 1.700 5.3e-03
Atopic dermatitis 1.300 4.3e-04
Breast cancer -1.100 7.2e-03
breast carcinoma 1.500 7.3e-03
cutaneous lupus erythematosus 3.700 1.9e-03
Down syndrome 1.200 2.5e-02
ductal carcinoma in situ 2.500 1.0e-03
esophageal adenocarcinoma 1.900 3.9e-02
glioblastoma 1.500 2.6e-03
group 3 medulloblastoma -1.100 4.5e-02
hepatocellular carcinoma -1.100 5.0e-02
intraductal papillary-mucinous carcinoma... -1.500 3.3e-02
invasive ductal carcinoma 2.769 2.8e-03
lung cancer -2.200 2.2e-03
lung carcinoma -2.100 3.6e-09
medulloblastoma, large-cell -1.600 6.3e-03
Multiple myeloma -1.023 2.8e-02
non primary Sjogren syndrome sicca -2.000 4.4e-03
non-small cell lung carcinoma 1.200 8.5e-12
oligodendroglioma 1.500 3.0e-06
ovarian cancer 2.400 2.6e-04
pancreatic cancer 1.100 3.0e-02
periodontitis 1.800 2.5e-19
posterior fossa group A ependymoma 1.800 1.7e-05
psoriasis 2.000 6.3e-07
tuberculosis -3.700 2.3e-06
ulcerative colitis 2.700 2.2e-04
urothelial carcinoma -2.900 2.7e-06

Protein-protein Interaction (1)

Gene RIF (30)

AA Sequence

MRAAAISTPKLDKMPGMFFSANPKELKGTTHSLLDDKMQKRRPKTFGMDMKAYLRSMIPHLESGMKSSKS      1 - 70
KDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACEDYKKTESDLLPCKAEEIYKAF     71 - 140
VHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQANSLK     141 - 209
//

Text Mined References (45)

PMID Year Title