Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 2.12

Knowledge Summary

Patent

No data available

Expression

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQP      1 - 70
DVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTI     71 - 140
GCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRS    141 - 210
LHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPS    211 - 280
VSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTW    281 - 350
TGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI                                 351 - 391
//

Text Mined References (10)

PMID Year Title