Property Summary

NCBI Gene PubMed Count 51
PubMed Score 478.16
PubTator Score 90.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Gene RIF (33)

AA Sequence

MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYV      1 - 70
ATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPD     71 - 140
HHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDA    141 - 210
EGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGG    211 - 280
IFKITGLGVKGIAPYSYAG                                                       281 - 299
//

Text Mined References (53)

PMID Year Title