Property Summary

NCBI Gene PubMed Count 38
PubMed Score 254.27
PubTator Score 48.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 2.000 6.5e-04
oligodendroglioma 2.100 7.0e-04
glioblastoma 1.600 2.9e-04
non-small cell lung cancer 1.495 1.4e-07
intraductal papillary-mucinous adenoma (... -1.300 3.9e-04
intraductal papillary-mucinous carcinoma... -1.300 4.5e-04
breast carcinoma -1.800 9.9e-06
adult high grade glioma 1.400 6.9e-04
invasive ductal carcinoma -2.400 4.7e-05
psoriasis -1.200 1.5e-09
non-inflammatory breast cancer -2.100 3.3e-03
ductal carcinoma in situ -1.600 2.7e-04

Gene RIF (14)

PMID Text
26721439 Thus, we conclude that RGMa inhibits angiogenesis in vitro and in vivo suggesting that its manipulation would be an efficient therapeutic strategy for pro-angiogenic conditions.
22396795 identification of neogenin-binding site on the repulsive guidance molecule A
22367090 RGMa expression and promoter methylation status are closely related to colorectal cancer genesis and progression.
22076499 The expression of RGMA, RGMB and RGMC was evident in most examined prostate cancer cell lines, and also in the prostate cancer tissues
21617229 Reduced expression of RGMA in breast cancer was associated with breast cancer.
21467223 RGM-A is a unique endogenous inhibitor of leukocyte chemotaxis that limits inflammatory leukocyte traffic
21183991 The full-length signal peptides of RGMa is functional and furthermore that the C-domains are sufficient and essential for ER targeting, whereas the N-domains are dispensable. Thus, the N-domains are available for additional functions.
20072140 Observational study of gene-disease association. (HuGE Navigator)
19303019 Frequent inactivation of axon guidance molecule RGMA in human colon cancer through genetic and epigenetic mechanisms.
19273616 this study, we show that Unc5B, a member of the netrin receptor family, interacts with neogenin as a coreceptor for RGMa.
18367154 Observational study of gene-disease association. (HuGE Navigator)
17606441 detected a homozygous deletion of chromosomal region 15q26.2 in the cell line HDLM2 encompasing RGMA and CHD2
17472960 RGMa facilitates the use of ActRIIA by endogenous BMP2 and BMP4 ligands that otherwise prefer signaling via BMPRII and increased utilization of ActRIIA leads to generation of an enhanced BMP signal
16216939 Following central nervous system injury, RGM, a novel, potent axonal growth inhibitor, is present in axonal growth impediments: the mature myelin, choroid plexus, and components of the developing scar.

AA Sequence

MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASD      1 - 70
DTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSD     71 - 140
SPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAA    141 - 210
TATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTT    211 - 280
IVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPT    281 - 350
APETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDL    351 - 420
PGRAAAGLPLAPRPLLGALVPLLALLPVFC                                            421 - 450
//

Text Mined References (39)

PMID Year Title
26721439 2016 Repulsive guidance molecule A suppresses angiogenesis.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23028342 2012 New susceptibility loci associated with kidney disease in type 1 diabetes.
22728873 2012 The hemochromatosis proteins HFE, TfR2, and HJV form a membrane-associated protein complex for hepcidin regulation.
22566498 2012 Genomic association analysis identifies multiple loci influencing antihypertensive response to an angiotensin II receptor blocker.
22396795 2012 Identification of the neogenin-binding site on the repulsive guidance molecule A.
22367090 2012 Decreased expression of repulsive guidance molecule member A by DNA methylation in colorectal cancer is related to tumor progression.
22076499 2012 Repulsive guidance molecules, novel bone morphogenetic protein co-receptors, are key regulators of the growth and aggressiveness of prostate cancer cells.
21617229 2011 Potential prognostic value of repulsive guidance molecules in breast cancer.
21467223 2011 Repulsive guidance molecule-A (RGM-A) inhibits leukocyte migration and mitigates inflammation.
21183991 2011 Long signal peptides of RGMa and DCBLD2 are dissectible into subdomains according to the NtraC model.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20072140 2010 RGMA and IL21R show association with experimental inflammation and multiple sclerosis.
19698085 2009 Molecular biology, genetics and biochemistry of the repulsive guidance molecule family.
19458235 2009 Inactivation of Ras by p120GAP via focal adhesion kinase dephosphorylation mediates RGMa-induced growth cone collapse.
19303019 2009 Frequent inactivation of axon guidance molecule RGMA in human colon cancer through genetic and epigenetic mechanisms.
19273616 2009 Unc5B associates with LARG to mediate the action of repulsive guidance molecule.
18485097 2008 Emerging roles for neogenin and its ligands in CNS development.
18367154 2008 Linkage disequilibrium mapping of a chromosome 15q25-26 major depression linkage region and sequencing of NTRK3.
17615080 2007 Role of RGM coreceptors in bone morphogenetic protein signaling.
17606441 2007 A detailed inventory of DNA copy number alterations in four commonly used Hodgkin's lymphoma cell lines.
17472960 2007 Repulsive guidance molecule RGMa alters utilization of bone morphogenetic protein (BMP) type II receptors by BMP2 and BMP4.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16216939 2005 Central nervous system injury-induced repulsive guidance molecule expression in the adult human brain.
15975920 2005 Repulsive guidance molecule (RGMa), a DRAGON homologue, is a bone morphogenetic protein co-receptor.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15258590 2004 Neogenin mediates the action of repulsive guidance molecule.
15084667 2004 The repulsive guidance molecule RGMa is involved in the formation of afferent connections in the dentate gyrus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.