Property Summary

NCBI Gene PubMed Count 35
PubMed Score 150.77
PubTator Score 26.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma -1.700 5.2e-05
Atopic dermatitis -1.100 9.6e-03
atypical teratoid / rhabdoid tumor -1.400 2.4e-03
Breast cancer -2.300 5.2e-12
breast carcinoma -1.200 4.4e-15
Chronic Lymphocytic Leukemia 1.538 3.1e-02
Common variable immunodeficiency -1.163 3.9e-03
cystic fibrosis 1.400 1.8e-02
Down syndrome 1.400 2.8e-03
ductal carcinoma in situ -1.400 3.0e-03
group 3 medulloblastoma -1.300 1.1e-03
interstitial cystitis 1.400 2.1e-03
intraductal papillary-mucinous adenoma (... -2.200 3.8e-04
intraductal papillary-mucinous carcinoma... -2.100 1.0e-02
intraductal papillary-mucinous neoplasm ... -2.500 5.8e-03
invasive ductal carcinoma -1.700 7.0e-05
lung adenocarcinoma -1.600 4.1e-14
lung cancer -4.600 2.1e-07
lung carcinoma -2.700 7.3e-25
malignant mesothelioma 4.100 1.9e-09
medulloblastoma, large-cell -2.800 2.3e-06
non-small cell lung cancer -2.931 3.3e-40
ovarian cancer 1.200 3.3e-02
primitive neuroectodermal tumor -1.100 9.4e-03
tuberculosis -1.700 4.3e-03
ulcerative colitis 3.300 1.9e-07
urothelial carcinoma 1.500 1.3e-02
Waldenstrons macroglobulinemia 2.076 3.5e-02

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSD      1 - 70
SSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM        71 - 137
//

Text Mined References (37)

PMID Year Title