Property Summary

NCBI Gene PubMed Count 5
PubMed Score 8.41
PubTator Score 3.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.800 1.1e-16

Gene RIF (1)

PMID Text
18976975 Knockdown of retrotransposon gag domain containing 4 (RGAG4) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSEASGNLNSLRMANVALREELNALRGENANLGLQLGRALAEVNSLRGNVSSYIRWPVPIVPVLAEENLE      1 - 70
FALSEIEVIPGGELPFLCRPPPRAEPDCISDDLLINVIQDRSTPDGPADPPLLPIPPPPALPPPASKEPP     71 - 140
PQPPLAPLERPEIEPFSGDPVYLAEFLMQLETFIADHEVHFPGGAERVAFLISFFTGEAKDWAISVTQEG    141 - 210
SPLHANFPRFLDEIRKEFCGPIPPRVAKKAIRKLKQGHCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGL    211 - 280
SEFFRKELLWSTEMADLDELILECVEIERKVRVPKPIPLPGVRNIIFPFAPSPNEEESEDEEYYSEDEDQ    281 - 350
EARRHRLHSKDQRKRMRAFQQEMKEKEEEEMKKEEEMKKKEEKEEEEEEEMKQKEEEEEIRNKNEEEGES    351 - 420
KDEEDEDEDGGQKPEGEPQQDPGTEETYGEVEEEPLDEAQDDDLDELMEMEPTFVHASSQTSGPTSGYHA    421 - 490
ENFLGASPPIIQPSRRRNQNRVPLLEGLPGTNSPFYSSPQLIRRTGRLGQRQVRRRPPVLFRLTPRQGGH    491 - 560
RAARGRIRV                                                                 561 - 569
//

Text Mined References (7)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16093683 2005 A family of neofunctionalized Ty3/gypsy retrotransposon genes in mammalian genomes.
15772651 2005 The DNA sequence of the human X chromosome.
15716091 2005 Transposable elements as a source of genetic innovation: expression and evolution of a family of retrotransposon-derived neogenes in mammals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12056414 2002 Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method.