Property Summary

NCBI Gene PubMed Count 15
PubMed Score 342.51
PubTator Score 18.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.200 1.5e-02
lung carcinoma 1.700 6.1e-06
Breast cancer -2.400 6.6e-26

Gene RIF (12)

PMID Text
26537068 association of the THADA, FOXP4, GPRC6A/RFX6 and 8q24 genes with prostate cancer in Asian populations.
26264437 study reports two individuals each with compound heterozygous RFX6 nonsense mutations and an intestinal phenotype consistent with Mitchell-Riley syndrome, but with onset of diabetes in childhood rather than in the first 2 weeks of life
25497100 RFX6 controls insulin gene transcription, insulin content, and secretion by regulation of Ca(2+)-channel genes.
24390282 A prostate cancer susceptibility allele at 6q22 increases RFX6 expression by modulating HOXB13 chromatin binding.
23803082 rs339331 in the RFX6 gene may be associated with prostate cancer as a susceptibility locus.
22662242 Our results provide further support for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in Eastern Asian populations
21965172 RFX6 mutation is responsible for neonatal diabetes syndrome.
21750414 Therefore, RFX6 appears to have a pivotal role in the maintenance of the phenotype of the beta-cells in addition to their development.
21215266 In early development Rfx6 plays a broad role, being essential for development of most anterior endodermal organs. At later stages however, Rfx6 function is restricted to endocrine cells.
20676098 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20148032 studies demonstrate a unique position for Rfx6 in the hierarchy of factors that coordinate pancreatic islet development in both mice and humans
18673564 RFX6 is a winged helix transcription factor expressed almost exclusively in the pancreatic islets.

AA Sequence

MAKVPELEDTFLQAQPAPQLSPGIQEDCCVQLLGKGLLVYPEETVYLAAEGQPGGEQGGGEKGEDPELPG      1 - 70
AVKSEMHLNNGNFSSEEEDADNHDSKTKAADQYLSQKKTITQIVKDKKKQTQLTLQWLEENYIVCEGVCL     71 - 140
PRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFPLLTTRRLGTRGHSKYHYYGIGIKESSAYYHSVYSG    141 - 210
KGLTRFSGSKLKNEGGFTRKYSLSSKTGTLLPEFPSAQHLVYQGCISKDKVDTLIMMYKTHCQCILDNAI    211 - 280
NGNFEEIQHFLLHFWQGMPDHLLPLLENPVIIDIFCVCDSILYKVLTDVLIPATMQEMPESLLADIRNFA    281 - 350
KNWEQWVVSSLENLPEALTDKKIPIVRRFVSSLKRQTSFLHLAQIARPALFDQHVVNSMVSDIERVDLNS    351 - 420
IGSQALLTISGSTDTESGIYTEHDSITVFQELKDLLKKNATVEAFIEWLDTVVEQRVIKTSKQNGRSLKK    421 - 490
RAQDFLLKWSFFGARVMHNLTLNNASSFGSFHLIRMLLDEYILLAMETQFNNDKEQELQNLLDKYMKNSD    491 - 560
ASKAAFTASPSSCFLANRNKGSMVSSDAVKNESHVETTYLPLPSSQPGGLGPALHQFPAGNTDNMPLTGQ    561 - 630
MELSQIAGHLMTPPISPAMASRGSVINQGPMAGRPPSVGPVLSAPSHCSTYPEPIYPTLPQANHDFYSTS    631 - 700
SNYQTVFRAQPHSTSGLYPHHTEHGRCMAWTEQQLSRDFFSGSCAGSPYNSRPPSSYGPSLQAQDSHNMQ    701 - 770
FLNTGSFNFLSNTGAASCQGATLPPNSPNGYYGSNINYPESHRLGSMVNQHVSVISSIRSLPPYSDIHDP    771 - 840
LNILDDSGRKQTSSFYTDTSSPVACRTPVLASSLQTPIPSSSSQCMYGTSNQYPAQETLDSHGTSSREMV    841 - 910
SSLPPINTVFMGTAAGGT                                                        911 - 928
//

Text Mined References (17)

PMID Year Title
26537068 Association of THADA, FOXP4, GPRC6A/RFX6 genes and 8q24 risk alleles with prostate cancer in Northern Chinese men.
26264437 2015 Biallelic RFX6 mutations can cause childhood as well as neonatal onset diabetes mellitus.
25497100 2014 RFX6 regulates insulin secretion by modulating Ca2+ homeostasis in human ? cells.
25416956 2014 A proteome-scale map of the human interactome network.
24390282 2014 A prostate cancer susceptibility allele at 6q22 increases RFX6 expression by modulating HOXB13 chromatin binding.
23803082 2013 Susceptibility loci associations with prostate cancer risk in northern Chinese men.
22662242 2012 Replication and fine mapping for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in the Chinese population.
21965172 2011 Clinical characterization of a newly described neonatal diabetes syndrome caused by RFX6 mutations.
21750414 RFX6 is needed for the development and maintenance of the ?-cell phenotype.
21215266 2011 Functional analysis of Rfx6 and mutant variants associated with neonatal diabetes.
20676098 2010 Genome-wide association study identifies five new susceptibility loci for prostate cancer in the Japanese population.
20148032 2010 Rfx6 directs islet formation and insulin production in mice and humans.
18673564 2008 Identification and characterization of novel human tissue-specific RFX transcription factors.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.