Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.45
PubTator Score 13.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 2.700 3.0e-03
ependymoma 3.500 1.0e-02
oligodendroglioma 2.300 3.5e-03
glioblastoma multiforme 1.500 2.3e-12
group 4 medulloblastoma -4.500 1.6e-09
medulloblastoma, large-cell -4.700 8.9e-06
lung cancer 5.300 1.0e-06
ovarian cancer -1.300 1.6e-05
pituitary cancer -3.400 1.9e-04
psoriasis -1.700 4.2e-06

Gene RIF (5)

PMID Text
21084426 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
18218630 GPS2 interacts with RFX4_v3 to modulate transactivation of genes involved in brain morphogenesis, including Cx3Cl1
15940297 Observational study of gene-disease association. (HuGE Navigator)
15940297 The gene encoding the transcription factor RFX4 represents an excellent neurobiological and positional candidate gene for Bipolar disorder due to the potential involvement of RFX4 proteins in the regulation of circadian rhythms, linked to chromosome 12.

AA Sequence

MHCGLLEEPDMDSTESWIERCLNESENKRYSSHTSLGNVSNDENEEKENNRASKPHSTPATLQWLEENYE      1 - 70
IAEGVCIPRSALYMHYLDFCEKNDTQPVNAASFGKIIRQQFPQLTTRRLGTRGQSKYHYYGIAVKESSQY     71 - 140
YDVMYSKKGAAWVSETGKKEVSKQTVAYSPRSKLGTLLPEFPNVKDLNLPASLPEEKVSTFIMMYRTHCQ    141 - 210
RILDTVIRANFDEVQSFLLHFWQGMPPHMLPVLGSSTVVNIVGVCDSILYKAISGVLMPTVLQALPDSLT    211 - 280
QVIRKFAKQLDEWLKVALHDLPENLRNIKFELSRRFSQILRRQTSLNHLCQASRTVIHSADITFQMLEDW    281 - 350
RNVDLNSITKQTLYTMEDSRDEHRKLITQLYQEFDHLLEEQSPIESYIEWLDTMVDRCVVKVAAKRQGSL    351 - 420
KKVAQQFLLMWSCFGTRVIRDMTLHSAPSFGSFHLIHLMFDDYVLYLLESLHCQERANELMRAMKGEGST    421 - 490
AEVREEIILTEAAAPTPSPVPSFSPAKSATSVEVPPPSSPVSNPSPEYTGLSTTGAMQSYTWSLTYTVTT    491 - 560
AAGSPAENSQQLPCMRNTHVPSSSVTHRIPVYPHREEHGYTGSYNYGSYGNQHPHPMQSQYPALPHDTAI    561 - 630
SGPLHYAPYHRSSAQYPFNSPTSRMEPCLMSSTPRLHPTPVTPRWPEVPSANTCYTSPSVHSARYGNSSD    631 - 700
MYTPLTTRRNSEYEHMQHFPGFAYINGEASTGWAK                                       701 - 735
//

Text Mined References (24)

PMID Year Title
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21084426 2011 Genome-wide association study confirms BST1 and suggests a locus on 12q24 as the risk loci for Parkinson's disease in the European population.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
18673564 2008 Identification and characterization of novel human tissue-specific RFX transcription factors.
18378158 2008 Immune transcriptome alterations in the temporal cortex of subjects with autism.
18218630 2008 G-protein pathway suppressor 2 (GPS2) interacts with the regulatory factor X4 variant 3 (RFX4_v3) and functions as a transcriptional co-activator.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
17510980 2007 Regulatory factor X4 variant 3: a transcription factor involved in brain development and disease.
16893423 2006 Identification of potential target genes for RFX4_v3, a transcription factor critical for brain development.
16541075 2006 The finished DNA sequence of human chromosome 12.
16271074 2005 Identification of glioma-specific RFX4-E and -F isoforms and humoral immune response in patients.
16193984 2005 Identification of a novel substrate for tyrosine kinase in human testes.
15940297 2005 Identification of a potential bipolar risk haplotype in the gene encoding the winged-helix transcription factor RFX4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701801 2004 Restricted expression and photic induction of a novel mouse regulatory factor X4 transcript in the suprachiasmatic nucleus.
12925582 2003 Graded phenotypic response to partial and complete deficiency of a brain-specific transcript variant of the winged helix transcription factor RFX4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11682486 2002 Human regulatory factor X 4 (RFX4) is a testis-specific dimeric DNA-binding protein that cooperates with other human RFX members.
8600444 1996 RFX proteins, a novel family of DNA binding proteins conserved in the eukaryotic kingdom.
1603086 1992 Characterization of estrogen receptor variant mRNAs from human breast cancers.