Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.59
PubTator Score 7.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.100 2.5e-03
atypical teratoid / rhabdoid tumor 1.400 3.5e-04
Breast cancer -1.700 2.1e-19
ductal carcinoma in situ -1.100 1.1e-04
ependymoma 1.200 5.9e-03
glioblastoma 1.200 4.0e-04
group 3 medulloblastoma -1.100 5.2e-03
invasive ductal carcinoma -1.400 1.0e-04
lung adenocarcinoma -1.200 7.1e-11
medulloblastoma, large-cell 1.200 6.1e-04
nasopharyngeal carcinoma -1.400 1.4e-07
non-small cell lung cancer -1.695 7.9e-15
osteosarcoma 1.189 5.3e-05
ovarian cancer -1.100 9.0e-08
tuberculosis -1.100 3.0e-03

Gene RIF (6)

AA Sequence

MQNSEGGADSPASVALRPSAAAPPVPASPQRVLVQAASSNPKGAQMQPISLPRVQQVPQQVQPVQHVYPA      1 - 70
QVQYVEGGDAVYTNGAIRTAYTYNPEPQMYAPSSTASYFEAPGGAQVTVAASSPPAVPSHSMVGITMDVG     71 - 140
GSPIVSSAGAYLIHGGMDSTRHSLAHTSRSSPATLEMAIENLQKSEGITSHKSGLLNSHLQWLLDNYETA    141 - 210
EGVSLPRSSLYNHYLRHCQEHKLDPVNAASFGKLIRSVFMGLRTRRLGTRGNSKYHYYGIRLKPDSPLNR    211 - 280
LQEDTQYMAMRQQPMHQKPRYRPAQKTDSLGDSGSHSGLHSTPEQTMAVQSQHHQQYIDVSHVFPEFPAP    281 - 350
DLGSFLLQDGVTLHDVKALQLVYRRHCEATVDVVMNLQFHYIEKLWLSFWNSKASSSDGPTSLPASDEDP    351 - 420
EGAVLPKDKLISLCQCDPILRWMRSCDHILYQALVEILIPDVLRPVPSTLTQAIRNFAKSLEGWLTNAMS    421 - 490
DFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCE    491 - 560
ESVVQRLEQDFKLTLQQQSSLDQWASWLDSVVTQVLKQHAGSPSFPKAARQFLLKWSFYSSMVIRDLTLR    561 - 630
SAASFGSFHLIRLLYDEYMFYLVEHRVAEATGETPIAVMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPD    631 - 700
ARSLGEPLVKRERSDPNHSLQGI                                                   701 - 723
//

Text Mined References (23)

PMID Year Title