Property Summary

NCBI Gene PubMed Count 45
PubMed Score 292.69
PubTator Score 125.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.3e-09
malignant mesothelioma 3163 3.5e-06
psoriasis 6685 2.5e-04
Disease Target Count Z-score Confidence
Severe Combined Immunodeficiency 46 4.216 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.300 3.5e-06
psoriasis -1.300 2.5e-04
osteosarcoma -2.208 1.3e-09

Gene RIF (22)

PMID Text
25979195 therapeutic targets for childhood severe asthmatics identified thru DNA microarray
24952874 Data indicate that regulatory factor X transcription factor RFX-1 regulates SC-2001-mediated SHP-1 Phosphatase transcription in hepatocellular carcinoma cells.
24526308 regulatory factor 1 directly regulates CD44 expression in glioblastoma
22582395 RFX1 reduces cell proliferation through inhibiting the TGFbeta2-ERK signaling pathway. RFX1 blocks TGFbeta2 expression through its direct action on TGFbeta2 transcription.
22490869 NLRC5-mediated histocompatibiility class I gene induction requires the W/S and X1, X2 cis-regulatory elements.
22415835 Taken together, this study suggests ciliogenic RFX transcription factors regulate FGF-1B promoter activity and the maintenance of F1BGFP(+) NSPCs and GBM-SCs.
21719561 in serum- or IGF-1-stimulated breast cancer MCF-7 cells, JNK induces SHP1 expression through the binding of AP-4 and RFX-1 transcription factors to the epithelial tissue-specific SHP1 promoter.
21192791 RFX1 recruits SUV39H1 to the promoter regions of the CD11a and CD70 genes in CD4(+) T cells, thereby regulating local H3K9 tri-methylation levels.
20381594 We show binding of RFX proteins to an evolutionarily conserved X-box in the ALMS1 proximal promoter and present evidence that these proteins are responsible for ALMS1 transc
20223637 regulates autoimmunity via epigenetic modifications in T cells of systemic lupus erythematosus patients
20189986 RFX1 may negatively regulate the self-renewal of GBM-SCs through modulating FGF-1B and FGF1 expression levels by binding the 18-bp cis-elements of the F1B promoter.
19620312 RFX and/or enhanceosome assembly plays a key role independent of transcriptional coactivator CIITA in protecting major histocompatibility class II antigen promoters against DNA methylation.
19334528 RFX1 specifically bind to promoter region and negatively regulate the transcription of the human PNRC gene.
17630394 RFX1 mediates the immediate early response of the Id2 gene by serum stimulation and suggest that the function of RFX1 is regulated intramolecularly in its suppression in growth-arrested cells.
16464847 results demonstrate that RFX1 and RFX5 differentially interact with class I HDACs underlying the different pathways when repressing collagen synthesis
16289097 The binding of alpha Adducin to RFX-I and their nuclear co-localization suggests that Adducin can have a role in modulating the transcriptional regulating activity of RFX-I.
16287876 evidence for a common mechanism for Crt1 and Rfx1 expression and for the conservation of their mode of action in response to a DNA replication block in yeasts and humans
15528357 Six novel S'-Y' regulatory modules have been identified that are controlled by the human major histocompatibility class II-specific regulatory factor RFX complex.
15334059 RFX1 gene may be epigenetically silenced in human gliomas and involved in glioma tumorigenesis.
15024578 novel role for the RFX family of transcription factors as modulators of Ras signalling in epithelial cells
12624117 Disruption of the RFX site within 263P blunts repressor activity in transfected GC cells; however, repression is only abolished when both PSE-A/RFX and PSE-B/NF-1 sites are mutated.
12411430 Data show that two regulatory factor for X box (RFX1 and 3) binding sites in exon1 of both the mouse and human microtubule-associated protein (MAP1A) gene are important for effective transcriptional repression in non-neuronal cells.

AA Sequence

MATQAYTELQAAPPPSQPPQAPPQAQPQPPPPPPPAAPQPPQPPTAAATPQPQYVTELQSPQPQAQPPGG      1 - 70
QKQYVTELPAVPAPSQPTGAPTPSPAPQQYIVVTVSEGAMRASETVSEASPGSTASQTGVPTQVVQQVQG     71 - 140
TQQRLLVQTSVQAKPGHVSPLQLTNIQVPQQALPTQRLVVQSAAPGSKGGQVSLTVHGTQQVHSPPEQSP    141 - 210
VQANSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPGPVQPLTVQGLQPVHVAQEVQ    211 - 280
QLQQVPVPHVYSSQVQYVEGGDASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAV    281 - 350
ASSGSMPMYVSGSQVVASSTSTGAGASNSSGGGGSGGGGGGGGGGGGGGSGSTGGGGSGAGTYVIQGGYM    351 - 420
LGSASQSYSHTTRASPATVQWLLDNYETAEGVSLPRSTLYCHYLLHCQEQKLEPVNAASFGKLIRSVFMG    421 - 490
LRTRRLGTRGNSKYHYYGLRIKASSPLLRLMEDQQHMAMRGQPFSQKQRLKPIQKMEGMTNGVAVGQQPS    491 - 560
TGLSDISAQVQQYQQFLDASRSLPDFTELDLQGKVLPEGVGPGDIKAFQVLYREHCEAIVDVMVNLQFTL    561 - 630
VETLWKTFWRYNLSQPSEAPPLAVHDEAEKRLPKAILVLLSKFEPVLQWTKHCDNVLYQGLVEILIPDVL    631 - 700
RPIPSALTQAIRNFAKSLESWLTHAMVNIPEEMLRVKVAAAGAFAQTLRRYTSLNHLAQAARAVLQNTAQ    701 - 770
INQMLSDLNRVDFANVQEQASWVCRCEDRVVQRLEQDFKVTLQQQNSLEQWAAWLDGVVSQVLKPYQGSA    771 - 840
GFPKAAKLFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMYYLIEHRVAQAKGETPIAVMGEFA    841 - 910
NLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS     911 - 979
//

Text Mined References (53)

PMID Year Title
27283392 2016 Transcription factor RFX1 is ubiquitinated by E3 ligase STUB1 in systemic lupus erythematosus.
25979195 Identification of therapeutic targets for childhood severe asthmatics with DNA microarray.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24952874 2014 RFX1-dependent activation of SHP-1 induces autophagy by a novel obatoclax derivative in hepatocellular carcinoma cells.
24526308 2014 Regulatory factor X1 is a new tumor suppressive transcription factor that acts via direct downregulation of CD44 in glioblastoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22582395 2012 Regulatory factor X1-induced down-regulation of transforming growth factor ?2 transcription in human neuroblastoma cells.
22490869 2012 NLRC5 cooperates with the RFX transcription factor complex to induce MHC class I gene expression.
22415835 2012 Ciliogenic RFX transcription factors regulate FGF1 gene promoter.
21719561 2011 Breast cancer cells proliferation is regulated by tyrosine phosphatase SHP1 through c-jun N-terminal kinase and cooperative induction of RFX-1 and AP-4 transcription factors.
21269460 2011 Initial characterization of the human central proteome.
21192791 2010 RFX1 regulates CD70 and CD11a expression in lupus T cells by recruiting the histone methyltransferase SUV39H1.
20381594 2010 Transcriptional regulation of the Alström syndrome gene ALMS1 by members of the RFX family and Sp1.
20223637 2010 Epigenetics and SLE: RFX1 downregulation causes CD11a and CD70 overexpression by altering epigenetic modifications in lupus CD4+ T cells.
20189986 2010 Regulation of FGF1 gene promoter through transcription factor RFX1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19620312 2009 The transcription factor RFX protects MHC class II genes against epigenetic silencing by DNA methylation.
19334528 [Transcriptional regulation of the human gene coding for proline-rich nuclear receptor coactivator (pnrc) by regulatory factor x (rfx1)].
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18673564 2008 Identification and characterization of novel human tissue-specific RFX transcription factors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17630394 2007 RFX1 mediates the serum-induced immediate early response of Id2 gene expression.
16464847 2006 Regulatory factor for X-box family proteins differentially interact with histone deacetylases to repress collagen alpha2(I) gene (COL1A2) expression.
16289097 2005 RFX-1, a putative alpha Adducin interacting protein in a human kidney library.
16287876 2005 Autorepression of rfx1 gene expression: functional conservation from yeast to humans in response to DNA replication arrest.
15528357 2004 Long distance control of MHC class II expression by multiple distal enhancers regulated by regulatory factor X complex and CIITA.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334059 2004 Identification of an epigenetically silenced gene, RFX1, in human glioma cells using restriction landmark genomic scanning.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15024578 2004 Involvement of RFX proteins in transcriptional activation from a Ras-responsive enhancer element.
12624117 2003 RFX1 and NF-1 associate with P sequences of the human growth hormone locus in pituitary chromatin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411430 2003 Role for RFX transcription factors in non-neuronal cell-specific inactivation of the microtubule-associated protein MAP1A promoter.
11986307 2002 The RFX family interacts at the collagen (COL1A2) start site and represses transcription.
11682486 2002 Human regulatory factor X 4 (RFX4) is a testis-specific dimeric DNA-binding protein that cooperates with other human RFX members.
11358531 2001 Nuclear import and DNA-binding activity of RFX1. Evidence for an autoinhibitory mechanism.
10706293 2000 Structure of the winged-helix protein hRFX1 reveals a new mode of DNA binding.
10642512 2000 Induction of Myc-intron-binding polypeptides MIBP1 and RFX1 during retinoic acid-mediated differentiation of haemopoietic cells.
10330134 1999 Dimeric RFX proteins contribute to the activity and lineage specificity of the interleukin-5 receptor alpha promoter through activation and repression domains.
9733744 1998 RFX1, a single DNA-binding protein with a split dimerization domain, generates alternative complexes.
9583676 1998 The kinase activity of c-Abl but not v-Abl is potentiated by direct interaction with RFXI, a protein that binds the enhancers of several viruses and cell-cycle regulated genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8661125 1996 Locations of human and mouse genes encoding the RFX1 and RFX2 transcription factor proteins.
8600444 1996 RFX proteins, a novel family of DNA binding proteins conserved in the eukaryotic kingdom.
8413236 1993 RFX1 is identical to enhancer factor C and functions as a transactivator of the hepatitis B virus enhancer.
8289803 1994 RFX1, a transactivator of hepatitis B virus enhancer I, belongs to a novel family of homodimeric and heterodimeric DNA-binding proteins.
8224874 1993 Transcription factor RFX1 helps control the promoter of the mouse ribosomal protein-encoding gene rpL30 by binding to its alpha element.
2253877 1990 MHC class II regulatory factor RFX has a novel DNA-binding domain and a functionally independent dimerization domain.
1508204 1992 The DNA-binding defect observed in major histocompatibility complex class II regulatory mutants concerns only one member of a family of complexes binding to the X boxes of class II promoters.
1505960 1992 The genes for MHC class II regulatory factors RFX1 and RFX2 are located on the short arm of chromosome 19.