Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.90
PubTator Score 3.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.200 3.1e-06
psoriasis -1.500 1.4e-03
glioblastoma 1.200 5.7e-07
group 3 medulloblastoma 1.800 6.5e-06
medulloblastoma, large-cell 1.400 9.2e-04
primitive neuroectodermal tumor 1.500 3.6e-04
adrenocortical carcinoma 1.313 8.2e-05
lung cancer 2.100 2.7e-03
pediatric high grade glioma 1.200 1.8e-05
atypical teratoid/rhabdoid tumor 1.100 2.1e-05

Gene RIF (5)

PMID Text
26474068 RFWD3-dependent ubiquitination of RPA regulates repair at stalled replication forks.
21558276 RFWD3 is recruited to sites of DNA damage and facilitates RPA-mediated DNA damage signaling and repair
21504906 RFWD3 and RPA2 functionally interact and participate in replication checkpoint control
20173098 Study identifies RFWD3 as a positive regulator of p53 stability when the G(1) cell cycle checkpoint is activated and provides an explanation for how p53 is protected from degradation in the presence of high levels of Mdm2.
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAHEAMEYDVQVQLNHAEQQPAPAGMASSQGGPALLQPVPADVVSSQGVPSILQPAPAEVISSQATPPLL      1 - 70
QPAPQLSVDLTEVEVLGEDTVENINPRTSEQHRQGSDGNHTIPASSLHSMTNFISGLQRLHGMLEFLRPS     71 - 140
SSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSEELQV    141 - 210
SSSSDSDSDSSAEYGGVVDQAEESGAVILEEQLAGVSAEQEVTCIDGGKTLPKQPSPQKSEPLLPSASMD    211 - 280
EEEGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRKCPQCNKKARHSDIVVLYARTLRAL    281 - 350
DTSEQERMKSSLLKEQMLRKQAELESAQCRLQLQVLTDKCTRLQRRVQDLQKLTSHQSQNLQQPRGSQAW    351 - 420
VLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVKMLSTANMKSS    421 - 490
QYIPMHGKQIRGLAFSSYLRGLLLSASLDNTIKLTSLETNTVVQTYNAGRPVWSCCWCLDEANYIYAGLA    491 - 560
NGSILVYDVRNTSSHVQELVAQKARCPLVSLSYMPRAASAAFPYGGVLAGTLEDASFWEQKMDFSHWPHV    561 - 630
LPLEPGGCIDFQTENSSRHCLVTYRPDKNHTTIRSVLMEMSYRLDDTGNPICSCQPVHTFFGGPTCKLLT    631 - 700
KNAIFQSPENDGNILVCTGDEAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHI    701 - 770
YKWE                                                                      771 - 774
//

Text Mined References (17)

PMID Year Title
26474068 2015 RFWD3-Dependent Ubiquitination of RPA Regulates Repair at Stalled Replication Forks.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
23666239 2013 Meta-analysis identifies four new loci associated with testicular germ cell tumor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21558276 2011 RING finger and WD repeat domain 3 (RFWD3) associates with replication protein A (RPA) and facilitates RPA-mediated DNA damage response.
21504906 2011 E3 ligase RFWD3 participates in replication checkpoint control.
20173098 2010 RFWD3-Mdm2 ubiquitin ligase complex positively regulates p53 stability in response to DNA damage.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19690564 2009 A comprehensive framework of E2-RING E3 interactions of the human ubiquitin-proteasome system.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.