Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
oligodendroglioma 1.500 4.3e-02
astrocytoma 1.300 1.1e-10
osteosarcoma 2.259 2.2e-05
group 4 medulloblastoma -2.600 2.9e-07
atypical teratoid/rhabdoid tumor -1.600 1.6e-03
medulloblastoma, large-cell -2.400 8.3e-05
lung adenocarcinoma -1.100 6.4e-08
pilocytic astrocytoma 1.300 5.5e-04

Synonym

Accession Q52LD8 Q14DH4 Q2TA69 Q53QE0 Q53SE1 Q96NM3
Symbols C2orf11
Raftlin-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSNPEVIKINSILDIVTKVENYY      1 - 70
LKGYIVGAIHPVIQPVGQRKHLPASYLYRVVLLRLKLSPKNSAAPSGQRRPRLVIEECPLTSEAQTNDAA     71 - 140
KELIEKINVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESG    141 - 210
IEEELHHESGQYQMEQNGSPTSSKSRKGEASDNKLYTVFNAFDDDSTSWAYQEGILSMKVTRKGSVISTL    211 - 280
DADWLELTTFYYKQGLSLIDSFVFWETSKGEHLPKSLEGFFIYEEEGSGVPGSSRKGNDAIVVEQWTVIE    281 - 350
GCEIKTDYGPLLHTLAEFGWLLTSVLPTPVLRHDSEGNLATKQIVFLQRPVMWNSAAQTPDKKASRHIKG    351 - 420
EDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFD    421 - 490
QEDGVTQVTCM                                                               491 - 501
//

Text Mined References (6)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.