Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.72
PubTator Score 0.78

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MVGRLSLQDVPELVDAKKKGDGVLDSPDSGLPPSPSPSHWGLAAGGGGGERAAAPGTLEPDAAAATPAAP      1 - 70
SPASLPLAPGCALRLCPLSFGEGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCV     71 - 140
PNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTTTLDYNCRKTLRRFLSSVELEAAELPGSDDL    141 - 210
SDEC                                                                      211 - 214
//

Text Mined References (11)

PMID Year Title