Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.43
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.600 1.1e-03
group 3 medulloblastoma 1.900 1.2e-05
intraductal papillary-mucinous adenoma (... 2.300 1.8e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
osteosarcoma 2.185 4.9e-05
ovarian cancer 1.200 4.8e-03
ulcerative colitis -1.200 1.4e-05

Gene RIF (1)

AA Sequence

MVGHLHLQGMEDSLKEQGREGLLDSPDSGLPPSPSPSPPFYSLAPGILDARAGGAGASSEPPGPSEARAP      1 - 70
PSQLPNPPASEMRPRMLPVFFGESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTVTAYSETIVA     71 - 140
APNCTWRNYRSQLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQLCQDPAPSL    141 - 210
LGPATL                                                                    211 - 216
//

Text Mined References (8)

PMID Year Title