Property Summary

NCBI Gene PubMed Count 45
PubMed Score 11.30
PubTator Score 5.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma 1.507 1.9e-04
adult high grade glioma -1.400 2.1e-02
astrocytic glioma -1.600 1.2e-02
atypical teratoid / rhabdoid tumor -2.100 7.7e-07
Bipolar Disorder -1.200 4.3e-02
Chronic Lymphocytic Leukemia 1.295 6.1e-03
ductal carcinoma in situ 1.100 2.4e-04
ependymoma -2.100 4.0e-03
glioblastoma -1.200 1.8e-02
group 3 medulloblastoma 1.600 5.0e-03
intraductal papillary-mucinous carcinoma... 1.300 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.500 1.1e-02
lung cancer 1.800 1.9e-02
malignant mesothelioma 1.500 2.3e-07
medulloblastoma, large-cell 1.300 1.3e-05
nasopharyngeal carcinoma 1.500 7.3e-06
non-small cell lung cancer 1.478 2.8e-18
oligodendroglioma -1.500 1.0e-02
osteosarcoma -2.253 2.7e-06
ovarian cancer -1.200 4.9e-04
Parkinson's disease -1.700 8.7e-03
primitive neuroectodermal tumor 1.200 2.7e-04
psoriasis -1.600 1.8e-04

Protein-protein Interaction (10)

Gene RIF (6)

AA Sequence

METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINEDRLPHLLLYGPPGTGKTSTI      1 - 70
LACAKQLYKDKEFGSMVLELNASDDRGIDIIRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRR     71 - 140
VIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSS    141 - 210
GDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDI    211 - 280
LTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA              281 - 340
//

Text Mined References (49)

PMID Year Title