Property Summary

NCBI Gene PubMed Count 35
PubMed Score 19.70
PubTator Score 12.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 6.1e-07
glioblastoma 1.200 2.6e-06
group 3 medulloblastoma 1.400 1.6e-03
non-small cell lung cancer 1.015 6.7e-16
diabetes mellitus -1.200 5.1e-03
pediatric high grade glioma 1.200 4.1e-05

Gene RIF (9)

PMID Text
20574454 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18245774 RPA plays a regulatory role in DNA damage responses via repression of RFC2 ubiquitylation in human cells.
16413017 The cAMP functions as an upstream modulator that regulates the expression and nuclear translocation of RFC40 protein.
15655353 evidence is presented for a novel interaction between RFC40 and the RIalpha subunit of PKA; findings indicate that modulation in the formation of the RFC40-RIa complex is associated with decreased cell survival
12036885 Upregulation by BCR/ABL requires activation of STAT5 and plays a key role in the BCR/ABL-mediated cell protection from apoptosis.
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes RFC, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MEVEAVCGGAGEVEAQDSDPAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVP      1 - 70
NIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIIL     71 - 140
DEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKER    141 - 210
VPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGFGFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYK    211 - 280
ILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMA    281 - 350
PVAS                                                                      351 - 354
//

Text Mined References (41)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20226869 2010 Association between genetic variants in the base excision repair pathway and outcomes after hematopoietic cell transplantations.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18499658 2008 Studies with the human cohesin establishment factor, ChlR1. Association of ChlR1 with Ctf18-RFC and Fen1.
18245774 2008 DNA damage-induced ubiquitylation of RFC2 subunit of replication factor C complex.
16413017 2006 Cyclic AMP regulates the expression and nuclear translocation of RFC40 in MCF7 cells.
15655353 2005 The second subunit of the replication factor C complex (RFC40) and the regulatory subunit (RIalpha) of protein kinase A form a protein complex promoting cell survival.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15096576 2004 Mutual interactions between subunits of the human RNase MRP ribonucleoprotein complex.
14605214 2003 Replication protein A-mediated recruitment and activation of Rad17 complexes.
12930902 2003 The alternative Ctf18-Dcc1-Ctf8-replication factor C complex required for sister chromatid cohesion loads proliferating cell nuclear antigen onto DNA.
12853948 2003 The DNA sequence of human chromosome 7.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12766176 2003 Cloning and characterization of hCTF18, hCTF8, and hDCC1. Human homologs of a Saccharomyces cerevisiae complex involved in sister chromatid cohesion establishment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12192049 2002 A Mammalian bromodomain protein, brd4, interacts with replication factor C and inhibits progression to S phase.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
12036885 2002 Complementary functions of the antiapoptotic protein A1 and serine/threonine kinase pim-1 in the BCR/ABL-mediated leukemogenesis.
11907025 2002 Structures of the human Rad17-replication factor C and checkpoint Rad 9-1-1 complexes visualized by glycerol spray/low voltage microscopy.
11003705 2000 Comparative genomic sequence analysis of the Williams syndrome region (LIMK1-RFC2) of human chromosome 7q11.23.
10783165 2000 BASC, a super complex of BRCA1-associated proteins involved in the recognition and repair of aberrant DNA structures.
10051561 1999 Studies on the interactions between human replication factor C and human proliferating cell nuclear antigen.
9822671 1998 Replication factor C disengages from proliferating cell nuclear antigen (PCNA) upon sliding clamp formation, and PCNA itself tethers DNA polymerase delta to DNA.
9488738 1998 Reconstitution of recombinant human replication factor C (RFC) and identification of an RFC subcomplex possessing DNA-dependent ATPase activity.
9228079 1997 A complex consisting of human replication factor C p40, p37, and p36 subunits is a DNA-dependent ATPase and an intermediate in the assembly of the holoenzyme.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9111189 1997 Which DNA polymerases are used for DNA-repair in eukaryotes?
8812460 1996 Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients.
8692848 1996 In vitro reconstitution of human replication factor C from its five subunits.
8651315 1996 The gene for replication factor C subunit 2 (RFC2) is within the 7q11.23 Williams syndrome deletion.
8093561 1993 The subunits of activator 1 (replication factor C) carry out multiple functions essential for proliferating-cell nuclear antigen-dependent DNA synthesis.
7774928 1995 Assignment of the 36.5-kDa (RFC5), 37-kDa (RFC4), 38-kDa (RFC3), and 40-kDa (RFC2) subunit genes of human replication factor C to chromosome bands 12q24.2-q24.3, 3q27, 13q12.3-q13, and 7q11.23.
1313560 1992 Sequence and expression in Escherichia coli of the 40-kDa subunit of activator 1 (replication factor C) of HeLa cells.