Property Summary

NCBI Gene PubMed Count 156
PubMed Score 26.54
PubTator Score 112.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Colonic Neoplasms 126
osteosarcoma 7933
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Progeria 22 3.233 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.014 1.0e-02
intraductal papillary-mucinous carcinoma... -1.100 4.7e-03
ovarian cancer -1.500 3.5e-05

Gene RIF (128)

PMID Text
25778468 We conclude that bearing allele G of rs1051266 polymorphism in RFC1 may contribute to increased efficacy of MTX treatment and may contribute to improved outcome in osteosarcoma patients
25730024 We found that the compound mutation genotypes MTHFD-G1958A, MTR-A2756G, and RFC1-G80A increased the risk of preterm birth (OR = 2.88, 95%CI = 1.08-7.72, P = 0.028).
25697897 this is the first study to simultaneously evaluate both DNA methylation and protein expression of all three folate transporter genes, FOLR1, PCFT, and RFC1, in colorectal cancer.
25536437 The frequency of RFC-1 rs1051266 (G80A) was 58.4% and 57.1% in children with nephroblastoma and neuroblastoma, respectively. Mother and child G80A genotypes play a role in the risk of neuroblastoma and nephroblastoma.
25071216 RFC depletion had a negative impact on LANA's ability to replicate and maintain viral DNA in cells containing artificial KSHV episomes or in infected cells, leading to loss of virus.
24942095 3 biallelic polymorphic variants (rs1051266, rs4818789 and rs3788205) were selected. Results provided support suggesting role of RFC1 in NSCL/P etiology, reinforcing idea genetic predisposition to NSCL/P varies in different ethnic groups.
24333266 One-carbon genetic variants influence epigenetic of MHC2TA and RFC1, thus contributing to phenotypic heterogeneity of systemic lupus erythematosus.
23857226 Maternal RFC-1 80A>G polymorphism might be associated with an increased risk of having a birth with Down Syndrome. [Meta-analysis]
23430030 The combined presence of RFC1 mutant alleles and the cystathionine b-synthase homozygous mutant allele was associated with a 4.81-fold increased risk of having a child with Down syndrome (95 % CI 1.82-12.68, P = 0.0007).
23336575 The presence of the mutant MTHFR 1298C and also RFC 80A was linked to a decreased risk of developing chidlhood acute lymphoid leukemia (ALL).
22952233 phosphorylation of serine 51 on hLigI plays a critical role in regulating the interaction between hLigI and RFC, which is required for efficient DNA replication and repair.
22914600 These data suggest a role of the polymorphism G80A in RFC1 in the risk of relapse and the mortality risk in patients with acute lymphoblastic leukemia.
22868813 Data suggest that genotypes for the MTHFR C677T and RFC rs1051266 polymorphism might be associated with the risk of conotruncal heart defects.
22729036 High RFC1 is associated with adenocarcinoma in non-small-cell lung carcinoma EGFR [corrected] mutation.
22168243 report that the large subunit (RFC1) of replication factor C is cleaved in Hutchinson-Gilford progeria syndrome cells, leading to the production of a truncated RFC1 of ~ 75 kDa
21881118 We identified a variant in each of 3 genes (RFC1, SCN1A, ANPEP) potentially implicated in susceptibility to severe neurological complications in West Nile Virus disease.
21878957 677T and 1298C alleles of MTHFR and G80 RFC-1 show association with hyperhomocysteinemia.
21681722 We demonstrated no difference in tHcy, folates, vitamin B12 levels and allelic frequencies of C677T and G80A polymorphisms in MTHFR and RFC genes between obese and no obese Tunisian children.
21113649 the G80A mutation in the RFC1 gene is associated with a greater risk for sporadic breast cancer and oxidative DNA damage
21045269 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20948192 Observational study of gene-disease association. (HuGE Navigator)
20713449 Small interfering RNA-mediated knockdown of RFC1 impairs upstream removal of UV lesions and abrogates the downstream recruitment of DNA polymerase delta.
20661649 the A80G polymorphism of reduced folate carrier 1 (RFC1) gene may have a role in head and neck squamous cell carcinoma
20661649 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574454 Observational study of gene-disease association. (HuGE Navigator)
20544798 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20511665 Observational study of gene-disease association. (HuGE Navigator)
20472929 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468076 Observational study of gene-disease association. (HuGE Navigator)
20466634 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20335220 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20310006 Observational study of gene-disease association. (HuGE Navigator)
20237949 Observational study of gene-disease association. (HuGE Navigator)
20226869 Observational study of gene-disease association. (HuGE Navigator)
20141435 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20081198 analysis of the DNA-bound BRCA1 C-terminal region structure from human replication factor C p140 and model of the protein-DNA complex
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19858780 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19827168 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19776634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19774638 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19729796 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19706844 Meta-analysis of gene-disease association. (HuGE Navigator)
19548564 There was an association between RFC1 A80G variant and the risk of nonsymdromic cleft lip with or without palate.
19548564 Observational study of gene-disease association. (HuGE Navigator)
19533788 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19493349 Observational study of gene-disease association. (HuGE Navigator)
19461557 Observational study of gene-disease association. (HuGE Navigator)
19454010 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes RFC, during Tat-mediated transactivation of the HIV-1 LTR
19427504 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19307503 Clinical trial of gene-disease association. (HuGE Navigator)
19274320 Observational study of gene-disease association. (HuGE Navigator)
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19223468 a mutant version of hLigI, which mimics the hyperphosphorylated M-phase form of hLigI, does not interact with and is not inhibited by RFC, demonstrating that inhibition of ligation is dependent upon the interaction between hLigI and RFC
19208620 Data show that replication factor C (RFC), via several stimulatory motifs per molecule, potently activates flap endonuclease 1 (FEN1), making RFC a critical partner with FEN1 for the processing of eukaryotic Okazaki fragments.
19172696 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19159907 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19105199 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19093297 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19020309 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19019492 Observational study of gene-disease association. (HuGE Navigator)
18842806 Observational study of gene-disease association. (HuGE Navigator)
18823966 Neonatal RFC1 polymorphism influenced total homocysteinein neonates
18823966 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18799873 Observational study of gene-disease association. (HuGE Navigator)
18629538 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18607581 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18528741 Observational study of gene-disease association. (HuGE Navigator)
18458567 MTHFR 677C/T and RFC1 80G/A polymorphisms may serve as predictors of toxicity during maintenance chemotherapy in childhood acute lymphoblastic leukemia or lymphoma.
18447718 The results of this study suggest that genetic variants of methionine metabolism are associated with meningioma formation
18447718 Observational study of gene-disease association. (HuGE Navigator)
18406541 Observational study of gene-disease association. (HuGE Navigator)
18273817 The presence of the genetic polymorphism of RCF1 is a maternal risk factor for Down syndrome in Brazil.
18273817 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18258338 data suggested that the RFC1 A80G G allele was an APOE 4-independent risk factor for late-onset Alzheimer's disease (AD
18258338 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18204969 Observational study of gene-disease association. (HuGE Navigator)
18060320 Observational study of gene-disease association. (HuGE Navigator)
18023275 Observational study of gene-disease association. (HuGE Navigator)
18022874 Observational study of gene-disease association. (HuGE Navigator)
17702010 Observational study of gene-disease association. (HuGE Navigator)
17545166 Ctf18-RFC interacts physically with pol eta, which allows DNA replication forks to overcome interference by various template structures, including damaged DNA and DNA-protein complexes that maintain chromosome cohesion
17449906 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17439323 Observational study of gene-disease association. (HuGE Navigator)
17410198 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17325736 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17208363 Observational study of gene-disease association. (HuGE Navigator)
17181924 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17180579 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16845273 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16712703 Observational study of gene-disease association. (HuGE Navigator)
16596679 Observational study of gene-disease association. (HuGE Navigator)
16522921 Observational study of gene-disease association. (HuGE Navigator)
16471213 Observational study of gene-disease association. (HuGE Navigator)
16343969 Observational study of gene-disease association. (HuGE Navigator)
16284371 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16141796 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16115349 Observational study of gene-disease association. (HuGE Navigator)
16086047 Observational study of gene-disease association. (HuGE Navigator)
16019224 Observational study of gene-disease association. (HuGE Navigator)
15952116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15799025 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15772763 NMR resonance assignments of the BRCT region of the large subunit
15769366 Observational study of gene-disease association. (HuGE Navigator)
15677700 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15457444 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15231126 Observational study of genotype prevalence. (HuGE Navigator)
15198953 Observational study of gene-disease association. (HuGE Navigator)
15060097 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15059614 Observational study of gene-disease association. (HuGE Navigator)
15044114 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14632302 Observational study of genotype prevalence. (HuGE Navigator)
14561664 Observational study of gene-disease association. (HuGE Navigator)
12947101 destabilization of the RF-C complex by CDKs may inactivate the RF-C complex at the end of S phase
12855225 Observational study of gene-disease association. (HuGE Navigator)
12753319 Observational study of gene-disease association. (HuGE Navigator)
12707400 Observational study of gene-disease association. (HuGE Navigator)
12673279 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12509469 RFC (p140) has an important role as a regulator of transcription and NF-kappaB activity
12411325 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12045192 interaction with histone deacetylase HDAC1
11857541 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes RFC, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSD      1 - 70
SESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKKAASKSKENGRSTNSHLGTSN     71 - 140
MKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKKMVASKRKELSQNTDESGLNDEAIAKQLQLD    141 - 210
EDAELERQLHEDEEFARTLAMLDEEPKTKKARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERK    211 - 280
SYSPRKQSKYESSKESQQHSKSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGE    281 - 350
TKTPKKTKSSPAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLES    351 - 420
IERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYE    421 - 490
IAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAKTIKKETDVFWKSLDFKEQVA    491 - 560
EETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIGQQGDQSCANKLLRWLRNWQKSSSEDKKHAA    561 - 630
KFGKFSGKDDGSSFKAALLSGPPGVGKTTTASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIK    631 - 700
GFYSNGAASSVSTKHALIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDL    701 - 770
RFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRA    771 - 840
KKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGDMKKHLMLLSR    841 - 910
AADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLA    911 - 980
LHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSP    981 - 1050
FSKLDPKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMI   1051 - 1120
KKKTKSSKPSKPEKDKEPRKGKGKSSKK                                             1121 - 1148
//

Text Mined References (167)

PMID Year Title
25778468 2015 Impact of genetic variants of RFC1, DHFR and MTHFR in osteosarcoma patients treated with high-dose methotrexate.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25730024 2015 Association between SNPs in genes involved in folate metabolism and preterm birth risk.
25697897 2015 DNA methylation and expression of the folate transporter genes in colorectal cancer.
25536437 2015 RFC-1 80G>A polymorphism in case-mother/control-mother dyads is associated with risk of nephroblastoma and neuroblastoma.
25071216 2014 Kaposi's sarcoma-associated herpesvirus LANA recruits the DNA polymerase clamp loader to mediate efficient replication and virus persistence.
24942095 2014 RFC1 and non-syndromic cleft lip with or without cleft palate: an association based study in Italy.
24333266 2014 Epigenetic modulation of RFC1, MHC2TA and HLA-DR in systemic lupus erythematosus: association with serological markers and six functional polymorphisms of one-carbon metabolic pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23857226 2013 The reduced folate carrier (RFC-1) 80A>G polymorphism and maternal risk of having a child with Down syndrome: a meta-analysis.
23430030 2013 Polymorphisms in genes RFC-1/CBS as maternal risk factors for Down syndrome in China.
23336575 2013 Polymorphisms involved in folate metabolism pathways and the risk of the development of childhood acute leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22952233 2012 Phosphorylation of serine 51 regulates the interaction of human DNA ligase I with replication factor C and its participation in DNA replication and repair.
22914600 2012 Polymorphism G80A in the reduced folate carrier gene and its relationship to survival and risk of relapse in acute lymphoblastic leukemia.
22868813 2012 Methylenetetrahydrofolate reductase C677T and reduced folate carrier 80 G>A polymorphisms are associated with an increased risk of conotruncal heart defects.
22729036 2012 High expression of folate receptor alpha in lung cancer correlates with adenocarcinoma histology and EGFR [corrected] mutation.
22168243 2012 Replication factor C1, the large subunit of replication factor C, is proteolytically truncated in Hutchinson-Gilford progeria syndrome.
21881118 2011 Genetic variants and susceptibility to neurological complications following West Nile virus infection.
21878957 2012 Association of MTHFR and RFC1 gene polymorphism with hyperhomocysteinemia and its modulation by vitamin B12 and folic acid in an Indian population.
21681722 2011 C677t polymorphism of MTHFR and G80A polymorphism of RFC genes and their relation with homocysteine levels in obese Tunisian children.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21113649 2011 Aberrations in one-carbon metabolism induce oxidative DNA damage in sporadic breast cancer.
21045269 2010 Maternal gene polymorphisms involved in folate metabolism as risk factors for Down syndrome offspring in Southern Brazil.
20948192 2010 The G allele of transcobalamin 2 c.776C?G is associated with an unfavorable lipoprotein profile.
20713449 2010 Replication factor C recruits DNA polymerase delta to sites of nucleotide excision repair but is not required for PCNA recruitment.
20661649 2011 A80G polymorphism of reduced folate carrier 1 (RFC1) gene and head and neck squamous cell carcinoma etiology in Brazilian population.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20574454 2010 Polymorphisms in the base excision repair pathway and graft-versus-host disease.
20544798 2010 Genetic and lifestyle variables associated with homocysteine concentrations and the distribution of folate derivatives in healthy premenopausal women.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20511665 2010 Candidate gene association studies and risk of childhood acute lymphoblastic leukemia: a systematic review and meta-analysis.
20472929 2010 Folate pathway enzyme gene polymorphisms and the efficacy and toxicity of methotrexate in psoriatic arthritis.
20468076 2010 A functional polymorphism in the reduced folate carrier gene and DNA hypomethylation in mothers of children with autism.
20466634 2010 [Folate gene polymorphism and the risk of Down syndrome pregnancies in young Chinese women].
20335220 2010 The association of reduced folate carrier 80G>A polymorphism to outcome in childhood acute lymphoblastic leukemia interacts with chromosome 21 copy number.
20310006 2010 MTR polymorphic variant A2756G and retinoblastoma risk in Brazilian children.
20237949 2010 Genetic variants of folate and methionine metabolism and PCNSL incidence in a German patient population.
20226869 2010 Association between genetic variants in the base excision repair pathway and outcomes after hematopoietic cell transplantations.
20141435 2010 Relationship of the reduced folate carrier gene polymorphism G80A to methotrexate plasma concentration, toxicity, and disease outcome in childhood acute lymphoblastic leukemia.
20081198 2010 Structure of the DNA-bound BRCA1 C-terminal region from human replication factor C p140 and model of the protein-DNA complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19858780 2009 Gene-gene interactions in folate and adenosine biosynthesis pathways affect methotrexate efficacy and tolerability in rheumatoid arthritis.
19827168 2009 Genetic polymorphisms in folate pathway enzymes as a possible marker for predicting the outcome of methotrexate therapy in Japanese patients with rheumatoid arthritis.
19776634 2009 Folate nutritional genetics and risk for hypertension in an elderly population sample.
19774638 2010 Pharmacogenomic variations in treatment protocols for childhood acute lymphoblastic leukemia.
19729796 2009 Investigation of CBS, MTR, RFC-1 and TC polymorphisms as maternal risk factors for Down syndrome.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19706844 2009 Association of folate-pathway gene polymorphisms with the risk of prostate cancer: a population-based nested case-control study, systematic review, and meta-analysis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19548564 2009 [Relationship between genetic polymorphisms of RFC1 A80G and nonsymdromic cleft lip with or without palate].
19533788 2009 Evaluation of folate metabolism gene polymorphisms as risk factors for open and closed neural tube defects.
19493349 2009 118 SNPs of folate-related genes and risks of spina bifida and conotruncal heart defects.
19461557 2009 Genetic polymorphisms relevant for one-carbon metabolism show no effect on homocysteine plasma levels and DNA methylation in alcoholism.
19427504 2009 Effect of common polymorphisms in folate uptake and metabolism genes on frequency of micronucleated lymphocytes in a South Australian cohort.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19307503 2009 Randomized phase II and pharmacogenetic study of pemetrexed compared with pemetrexed plus carboplatin in pretreated patients with advanced non-small-cell lung cancer.
19274320 2008 A80G polymorphism of reduced folate carrier 1 (RFC1) and C776G polymorphism of transcobalamin 2 (TC2) genes in Down's syndrome etiology.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19223468 2009 Phosphorylation of human DNA ligase I regulates its interaction with replication factor C and its participation in DNA replication and DNA repair.
19208620 2009 Human replication factor C stimulates flap endonuclease 1.
19172696 2008 The reduced folate carrier (RFC1) 80G > A and folate hydrolase 1 (FOLH1) 1561C > T polymorphisms and the risk of colorectal cancer: a nested case-referent study.
19159907 2009 Methotrexate in pediatric osteosarcoma: response and toxicity in relation to genetic polymorphisms and dihydrofolate reductase and reduced folate carrier 1 expression.
19105199 2009 Association of reduced folate carrier gene polymorphism and maternal folic acid use with neural tube defects.
19093297 2008 Interaction of genes from influx-metabolism-efflux pathway and their influence on methotrexate efficacy in rheumatoid arthritis patients among Indians.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19020309 2009 Polymorphisms in folate-related genes and risk of pediatric acute lymphoblastic leukemia.
19019492 2010 Genetic variation in homocysteine metabolism, cognition, and white matter lesions.
18842806 2008 Associations between single nucleotide polymorphisms in folate uptake and metabolizing genes with blood folate, homocysteine, and DNA uracil concentrations.
18823966 2008 Relationships between gene polymorphisms of folate-related proteins and vitamins and metabolites in pregnant women and neonates.
18799873 2008 Polymorphisms of homocysteine metabolism are associated with intracranial aneurysms.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18629538 2008 Reduced folate carrier 80A-->G polymorphism, plasma folate, and risk of placental abruption.
18607581 2008 Genetic determinants of methotrexate toxicity in rheumatoid arthritis patients: a study of polymorphisms affecting methotrexate transport and folate metabolism.
18528741 2008 Polymorphisms and methylation of the reduced folate carrier in osteosarcoma.
18458567 2008 Influence of MTHFR and RFC1 polymorphisms on toxicities during maintenance chemotherapy for childhood acute lymphoblastic leukemia or lymphoma.
18447718 2008 Polymorphisms of methionine metabolism and susceptibility to meningioma formation: laboratory investigation.
18406541 2008 Folate pathway genetic polymorphisms and susceptibility of central nervous system tumors in Thai children.
18273817 2008 Genetic polymorphisms involved in folate metabolism and elevated plasma concentrations of homocysteine: maternal risk factors for Down syndrome in Brazil.
18258338 2009 Association of RFC1 A80G and MTHFR C677T polymorphisms with Alzheimer's disease.
18204969 2008 Polymorphisms in folate metabolizing enzymes and transport proteins and the risk of breast cancer.
18060320 2008 The MTR A2756G polymorphism is associated with an increase of plasma homocysteine concentration in Brazilian individuals with Down syndrome.
18023275 2008 Evaluation of nutritional and genetic determinants of total homocysteine, methylmalonic acid and S-adenosylmethionine/S-adenosylhomocysteine values in Brazilian childbearing-age women.
18022874 2008 Correlation of polymorphism of MTHFRs and RFC-1 genes with neural tube defects in China.
17702010 2007 Polymorphisms in folate and homocysteine metabolizing genes and chromosome damage in mothers of Down syndrome children.
17545166 2007 A second proliferating cell nuclear antigen loader complex, Ctf18-replication factor C, stimulates DNA polymerase eta activity.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17449906 2007 Genetic polymorphisms in one-carbon metabolism: associations with CpG island methylator phenotype (CIMP) in colon cancer and the modifying effects of diet.
17439323 2007 Associations of common polymorphisms in the thymidylate synthase, reduced folate carrier and 5-aminoimidazole-4-carboxamide ribonucleotide transformylase/inosine monophosphate cyclohydrolase genes with folate and homocysteine levels and venous thrombosis risk.
17410198 2007 Polymorphisms in folate, pyrimidine, and purine metabolism are associated with efficacy and toxicity of methotrexate in psoriasis.
17325736 2007 Reduced folate carrier-1 80G>A polymorphism affects methotrexate treatment outcome in rheumatoid arthritis.
17208363 2007 Gene polymorphisms of folate metabolizing enzymes and the risk of gastric cancer.
17181924 ABCB1 C3435T polymorphism influences methotrexate sensitivity in rheumatoid arthritis patients.
17180579 2007 Genetic polymorphisms associated with adverse events and elimination of methotrexate in childhood acute lymphoblastic leukemia and malignant lymphoma.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16845273 2006 Analysis of seven maternal polymorphisms of genes involved in homocysteine/folate metabolism and risk of Down syndrome offspring.
16712703 2006 Maternal MTR genotype contributes to the risk of non-syndromic cleft lip and palate in the Polish population.
16596679 2006 Folate gene polymorphisms and the risk of Down syndrome pregnancies in young Italian women.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16522921 2006 Interactions among polymorphisms in folate-metabolizing genes and serum total homocysteine concentrations in a healthy elderly population.
16471213 2005 [A parental case control study on the association between reduced folate carrier gene polymorphism and neural tube defects].
16438930 2006 Direct interaction between cohesin complex and DNA replication machinery.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16343969 2006 Reduced folate carrier polymorphisms and neural tube defect risk.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16284371 2005 Polymorphisms in the reduced folate carrier, thymidylate synthase, or methionine synthase and risk of colon cancer.
16141796 2005 The pharmacogenetics of methotrexate in inflammatory bowel disease.
16115349 2005 No association between common polymorphisms in genes of folate and homocysteine metabolism and the risk of Down's syndrome among French mothers.
16086047 2005 [Epidemiological study on reduced folate carrier gene(RFC1 A80G) polymorphism and other risk factors of neural tube defects].
16019224 2006 Genetic variation of infant reduced folate carrier (A80G) and risk of orofacial defects and congenital heart defects in China.
15952116 2005 Interaction between maternal periconceptional supplementation of folic acid and reduced folate carrier gene polymorphism of neural tube defects.
15799025 2005 Reduced folate carrier gene is a risk factor for neural tube defects in a Chinese population.
15772763 2005 1H, 15N and 13C resonance assignments of the BRCT region of the large subunit of human Replication Factor C.
15769366 2004 [Study on the association between reduced folate carrier gene polymorphism and congenital heart defects and cleft lip with or without cleft palate].
15677700 2005 Pharmacogenetic and metabolite measurements are associated with clinical status in patients with rheumatoid arthritis treated with methotrexate: results of a multicentred cross sectional observational study.
15655353 2005 The second subunit of the replication factor C complex (RFC40) and the regulatory subunit (RIalpha) of protein kinase A form a protein complex promoting cell survival.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15457444 2004 Polyglutamation of methotrexate with common polymorphisms in reduced folate carrier, aminoimidazole carboxamide ribonucleotide transformylase, and thymidylate synthase are associated with methotrexate effects in rheumatoid arthritis.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231126 2004 [Study on reduced folate carrier gene (RFC1) polymorphism in the southern and northern Chinese population].
15198953 2004 Polymorphisms and haplotypes in folate-metabolizing genes and risk of non-Hodgkin lymphoma.
15060097 2004 Gene-gene interaction in folate-related genes and risk of neural tube defects in a UK population.
15059614 2004 Low erythrocyte folate status and polymorphic variation in folate-related genes are associated with risk of neural tube defect pregnancy.
15044114 2004 Gene-nutrient and gene-gene interactions of controlled folate intake by Japanese women.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14632302 2003 Genotype frequencies and linkage disequilibrium in the CEPH human diversity panel for variants in folate pathway genes MTHFR, MTHFD, MTRR, RFC1, and GCP2.
14561664 2003 Genetic variation of infant reduced folate carrier (A80G) and risk of orofacial and conotruncal heart defects.
12947101 2003 Cell cycle-dependent phosphorylation of the large subunit of replication factor C (RF-C) leads to its dissociation from the RF-C complex.
12855225 2003 Evaluation of genetic variants in the reduced folate carrier and in glutamate carboxypeptidase II for spina bifida risk.
12766176 2003 Cloning and characterization of hCTF18, hCTF8, and hDCC1. Human homologs of a Saccharomyces cerevisiae complex involved in sister chromatid cohesion establishment.
12753319 2003 Effects of the glutamate carboxypeptidase II (GCP2 1561C>T) and reduced folate carrier (RFC1 80G>A) allelic variants on folate and total homocysteine levels in kidney transplant patients.
12707400 2003 Effect of glutamate carboxypeptidase II and reduced folate carrier polymorphisms on folate and total homocysteine concentrations in dialysis patients.
12673279 2003 Reduced folate carrier polymorphism (80A-->G) and neural tube defects.
12509469 2003 Regulation of RelA (p65) function by the large subunit of replication factor C.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12411325 2002 Polymorphism G80A in the reduced folate carrier gene and its relationship to methotrexate plasma levels and outcome of childhood acute lymphoblastic leukemia.
12220650 2002 Control of complex formation of DNA polymerase alpha-primase and cell-free DNA replication by the C-terminal amino acids of the largest subunit p180.
12192049 2002 A Mammalian bromodomain protein, brd4, interacts with replication factor C and inhibits progression to S phase.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
12045192 2002 The large subunit of replication factor C interacts with the histone deacetylase, HDAC1.
11877377 2002 SMC1 is a downstream effector in the ATM/NBS1 branch of the human S-phase checkpoint.
11857541 2002 Maternal periconceptional vitamin use, genetic variation of infant reduced folate carrier (A80G), and risk of spina bifida.
10783165 2000 BASC, a super complex of BRCA1-associated proteins involved in the recognition and repair of aberrant DNA structures.
10353443 1999 The DNA-binding subunit p140 of replication factor C is upregulated in cycling cells and associates with G1 phase cell cycle regulatory proteins.
9822671 1998 Replication factor C disengages from proliferating cell nuclear antigen (PCNA) upon sliding clamp formation, and PCNA itself tethers DNA polymerase delta to DNA.
9705493 1998 DNA recognition properties of the N-terminal DNA binding domain within the large subunit of replication factor C.
9563011 1997 Mapping specific protein-protein interactions within the core component of the breast cell DNA synthesome.
9488738 1998 Reconstitution of recombinant human replication factor C (RFC) and identification of an RFC subcomplex possessing DNA-dependent ATPase activity.
9351817 1997 The large subunit of replication factor C is a substrate for caspase-3 in vitro and is cleaved by a caspase-3-like protease during Fas-mediated apoptosis.
9235961 1997 The large subunit of the DNA replication complex C (DSEB/RF-C140) cleaved and inactivated by caspase-3 (CPP32/YAMA) during Fas-induced apoptosis.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9111189 1997 Which DNA polymerases are used for DNA-repair in eukaryotes?
8999859 1997 Replication factor C interacts with the C-terminal side of proliferating cell nuclear antigen.
8954124 1996 Replication factor C recognizes 5'-phosphate ends of telomeres.
8861969 1996 A conserved domain of the large subunit of replication factor C binds PCNA and acts like a dominant negative inhibitor of DNA replication in mammalian cells.
8692848 1996 In vitro reconstitution of human replication factor C from its five subunits.
8512577 1993 Cloning and expression of a novel human DNA binding protein, PO-GA.
8248204 1993 cDNAs encoding the large subunit of human replication factor C.
8114700 1994 Cloning, expression, and chromosomal localization of the 140-kilodalton subunit of replication factor C from mice and humans.
7914507 1994 The human DNA-binding protein, PO-GA, is homologous to the large subunit of mouse replication factor C: regulation by alternate 3' processing of mRNA.