Property Summary

NCBI Gene PubMed Count 25
PubMed Score 91.54
PubTator Score 33.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Gene RIF (16)

PMID Text
25937206 The data demonstrated that RELM-a is a promising novel biomarker of angiogenesis in patients with gastric cancer.
25545115 elevated RELM-beta expression in asthmatic airways contributes to airways remodelling at least partly by increasing fibroblast proliferation and differentiation with resulting deposition of extracellular matrix proteins.
25479529 RELMbeta levels were increased in Abdominal aortic aneurysm patients in the serum and in the aortic tissue. Increased RELMbeta levels may be involved in the pathogenesis of AAA formation and progress.
23702657 RELMbeta is abundantly expressed in foam cells within plaques and contributes to atherosclerosis development via lipid accumulation and inflammatory facilitation.
23392702 It is concluded that proper exercise training prevents up-regulation of FIZZ1/RELMalpha induced by cigarette smoking, which may be involved in the mechanism of proper exercise training modulating airway hyperresponsiveness.
22758223 RELM-beta may play an important role not only in animal models of airway remodelling, but also in human airway pathology.
22726462 Epithelial cell derived Fizz1 transgene is sufficient to increase bone-marrow derived dendritic cells in the lungs.
22371635 Data show that over-expression of RELMbeta abolishes the invasion, metastasis and angiogenesis of gastric cancer cells in vitro.
21828035 RELM-beta has the potential to contribute to airway remodelling in diseases such as asthma by acting on epithelial cells to increase proliferation, mucin and growth factor production, at least partly via ERK/MAPK-PI3K/Akt signalling pathways.
21602491 FIZZ2 is highly induced in lungs of human patients with idiopathic pulmonary fibrosis.
21094111 High RELMbeta is associated with colorectal cancer.
19967544 Gastric cncer patients showing positive RELMbeta expression had a significantly longer overall survival than those with negative expression (P = 0.001).
19251945 Results suggest that RELM-beta may be involved in the development of scleroderma-associated pulmonary hypertension.
18594973 Of the 80 colon cancer patients studied, 65 (81.25%) tested positive for RELM beta, mainly in the cytoplasm of colon mucosa.
14598255 High levels of RELMbeta can be detected in the stool of mice and humans, where it exists as a homodimer under nonreducing conditions.
12224133 Supernatant from COS cells transfected with the CCRG (RETNLB) expression vector stimulated proliferation of colon cancer cells, which supports the growth factor nature of the RETNLB gene.

AA Sequence

MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAG      1 - 70
MAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT                                  71 - 111
//

Text Mined References (25)

PMID Year Title
25937206 2015 High expression of RELM-? correlates with poor prognosis and promotes angiogenesis in gastric cancer.
25545115 2015 Resistin-like molecule-? (RELM-?) targets airways fibroblasts to effect remodelling in asthma: from mouse to man.
25479529 2015 Association of resistin-like molecule ? levels and abdominal aortic aneurysm.
23702657 2013 Resistin-like molecule ? is abundantly expressed in foam cells and is involved in atherosclerosis development.
23392702 2013 Exercise training attenuated chronic cigarette smoking-induced up-regulation of FIZZ1/RELM? in lung of rats.
22758223 2012 Resistin-like molecule-? is induced following bronchoconstriction of asthmatic airways.
22726462 2012 Resistin-like molecule ?1 (Fizz1) recruits lung dendritic cells without causing pulmonary fibrosis.
22371635 2012 Effects of resistin-like molecule ? over-expression on gastric cancer cells in vitro.
21828035 2012 Resistin-like molecule-? is a human airway remodelling mediator.
21602491 2011 FIZZ2/RELM-? induction and role in pulmonary fibrosis.
21094111 2011 Plasma levels of resistin-like molecule beta in humans.
19967544 2010 Expression of resistin-like molecule beta in gastric cancer: its relationship with clinicopathological parameters and prognosis.
19251945 2009 Resistin-like molecule-beta in scleroderma-associated pulmonary hypertension.
18594973 2009 Enhanced expression of resistin-like molecule beta in human colon cancer and its clinical significance.
16427636 2006 Human RELMbeta is a mitogenic factor in lung cells and induced in hypoxia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15064728 2004 Identification of murine and human XCP1 genes as C/EBP-epsilon-dependent members of FIZZ/Resistin gene family.
14598255 2003 Bacterial colonization leads to the colonic secretion of RELMbeta/FIZZ2, a novel goblet cell-specific protein.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12574343 2003 The Th2 cell cytokines IL-4 and IL-13 regulate found in inflammatory zone 1/resistin-like molecule alpha gene expression by a STAT6 and CCAAT/enhancer-binding protein-dependent mechanism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12224133 Bioinformatics-based discovery of a novel factor with apparent specificity to colon cancer.
11209052 2001 A family of tissue-specific resistin-like molecules.
11090083 2000 Representational difference analysis using myeloid cells from C/EBP epsilon deletional mice.
10921885 2000 FIZZ1, a novel cysteine-rich secreted protein associated with pulmonary inflammation, defines a new gene family.