Property Summary

NCBI Gene PubMed Count 483
PubMed Score 1325.44
PubTator Score 713.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
COPD -1.100 1.1e-02
gastric cancer -1.800 2.9e-02
lung adenocarcinoma -1.300 3.7e-04
non-small cell lung cancer -1.609 3.2e-18
osteosarcoma -3.283 4.7e-06

 GO Function (1)

Gene RIF (499)

AA Sequence

MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVT      1 - 70
GCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP                                     71 - 108
//

Text Mined References (485)

PMID Year Title