Property Summary

NCBI Gene PubMed Count 149
PubMed Score 228.35
PubTator Score 291.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 1.2e-02
glioblastoma 2.100 7.1e-07
posterior fossa group A ependymoma 2.000 8.7e-11
atypical teratoid / rhabdoid tumor 2.200 1.5e-08
medulloblastoma, large-cell 1.100 6.2e-04
primitive neuroectodermal tumor 1.700 1.4e-05
intraductal papillary-mucinous neoplasm ... 1.200 4.0e-02
lung cancer 1.800 1.1e-03
Breast cancer 3.700 2.4e-02
pediatric high grade glioma 2.100 7.7e-08
pilocytic astrocytoma 1.700 7.6e-07
lung carcinoma -2.000 3.0e-31
ovarian cancer 1.500 5.5e-09

Protein-protein Interaction (1)

Gene RIF (123)

PMID Text
26708060 A role was determined for the NRSF-BDNF pathway in the modulation of cognitive function in patients with newly diagnosed epilepsy.
26690059 a new role for REST in regulation of growth and early differentiation decisions in human embryonic stem cells.
26647819 REST represses transcription of HIF-1alpha in prolonged hypoxia, thus contributing to the resolution of the HIF-1alpha response.
26551668 Mutations in the transcriptional repressor REST predispose to Wilms tumor.
26341630 Results demonstrate that REST regulates AF1q gene transcription through direct binding at -383 to -363 bp of AF1q promoter.
26307266 Resveratrol via SIRT1/c-Jun downregulates REST mRNA and protein in SH-SY5Y cells.
26119235 Cultured astrocytes gradually became refractory to reprogramming, in part by the repressor REST preventing Neurog2 from binding to the NeuroD4 promoter.
26100015 loss of REST induces a pathogenic program that works through the type 1 insulin-like growth factor receptor/insulin receptor substrate 1 pathway.
26071481 The splicing of REST by SRRM4 could promote the neuroendocrine phenotype in CRPC.
26003726 pioglitazone can inhibit proliferation and induce apoptosis of glioma cell in vitro, which may be mediated by down-regulating REST mRNA level but not by inducing alternative splicing of REST pre-mRNA
25990720 The results demonstrate that there is substantial rewiring of human and mouse REST cistromes, and that REST may have human-specific roles in brain development and functions.
25613376 TSPYL2 is an essential component of the REST/NRSF transcriptional complex for TGFbeta signaling activation
25569790 Results indicate that neuron-restrictive silencer factor plays an important role as a repressor of VGF gene regulation in neuroblastoma cells through a mechanism that is dependent on VGF-neuron-restrictive silencer element
25559091 REST variant is associated with slower hippocampal atrophy in MCI/AD.
25524378 The results imply that NRSF/REST plays an important role in the survival of oral cancer cells by regulating the mTOR signaling pathway.
25453754 The STP-REST axis is a molecular driver of human triple-negative breast cancer subtype.
25424701 Assessment of REST-N50 and DOPEY1v2 may prove useful in diagnostic blood tests of breast cancer. REST-N50 shows a high potential as a blood biomarker for evaluating the effectiveness of therapy in the neoadjuvant setting.
25220237 REST represses PDYN expression in SH-SY5Y cells and the adult human brain and may have implications for mental health and brain/mental disorders.
25154622 identified and validated a novel promoter of the MIR137 gene adjacent to miR-137 itself which can direct the expression of distinct mRNA isoforms encoding miR-137; internal promoter is regulated by repressor element-1 silencing transcription factor (REST)
24740933 TRF2-mediated counterbalance between hREST4 and REST is vital for both the generation and maintenance of neural progenitor cells
24670762 REST levels during ageing are closely correlated with cognitive preservation and longevity; the activation state of REST may distinguish neuroprotection from neurodegeneration in the ageing brain
24634989 data support the notion of REST presence in human brain neurones and glial cells and indicate the importance of developing compounds able to restore REST-regulated transcription of neuronal genes in Huntington's disease.
24415532 Inhibition of REST suppressed tumor growth, inhibited pericyte marker expression, and increased tumor hypoxia and apoptosis
24235014 SNP rs13278062, but not rs1713985 showed nominal evidence of association with AMD in a total of 1273 cases and 1652 controls of Chinese descent.
24163104 Results demonstrate that REST modulates androgen receptor actions in prostate epithelia and that REST expression is negatively correlated with disease recurrence after prostatectomy.
24135225 REST is downregulated in advanced prostate cancer by hypoxia-induced miR-106 cluster genes.
24126098 the crucial regulatory function of NRSF in the heart and its importance for maintaining normal cardiac integrity. [review]
24068568 positive interaction between REST activity and miR-124a using a luciferase-binding assay and we correlated the reciprocal expression of REST and miR-124a in our clinical cohort
23928058 findings show that nSR100 plays a role in the alternative splicing of REST in small cell lung cancer (SCLC); study provides new insight into the role of nSR100 in the expression of sREST, possibly in the pathogenesis of SCLC
23651552 The role of REST in the various steps of the expression and function of the dense-core vesicle membrane is critical during development and participates in the dynamic regulation of mature cell physiology. [Review]
23598529 The transcriptional repressor REST binds to an RE-1 element in the STAT1 repressor region and in doing so represses transcription from the STAT1 gene regulatory region in melanoma cells lines.
23284171 demonstrate previously unrecognized roles for GPR10 and its upstream regulator REST in the pathogenesis of uterine fibroids
23250796 A conserved region of human and mouse SYN1 promoters contains cis-sites for the transcriptional activator Sp1 in close proximity to REST binding motifs.
23238568 localization of REST protein on the p85 promoter is inhibited by MDM2 protein.
23216891 A REST derived gene signature stratifies glioblastomas into chemotherapy resistant and responsive disease.
23168245 Taken together, we propose here that the down-regulatory effects of NRSF on hSCTR gene expression are mediated via its suppression on Sp1-mediated transactivation
23151521 Our data show that DN:REST in motor cortex reversed RESTs repressive effects on target genes.
23086924 Ischemia insult triggered by oxygen-glucose deprivation (OGD) enhances NRSF mRNA levels and then NRSF antagonizes the CREB signaling on CART activation, leading to augmented cell death.
23069678 these results demonstrate that REST, by regulating NCX1 expression, may represent a potential druggable target for the treatment of brain ischemia
22958208 Upon mutation of the NRSF/REST responsive element, promoter activity strongly increases with cell differentiation.
22821339 results indicate that REST-dependent TRF2 expression renders cancer cells resistant to DNA damage during oxidative stress, and mechanisms to overcome oxidative stress, such as high levels of REST or the stress-resistant REST mutants found in specific cancers may account for REST-dependent tumorigenesis
22792276 The REST N exon is a very versatile sequence with a complex array of splicing signals, and its activation in H69 cells depends on the relative amounts of hnRNP H and U2AF65.
22701651 REST controls self-renewal and tumorigenic competence of human glioblastoma cells.
22684772 negative REST and positive TUBB3 protein expression was detected as independent prognostic factors.
22668508 REST is a novel gene regulated by EGF in HeLa cells that potentially contributes to the modulation of apoptosis via epigenetic mechanisms.
22665064 USP37 links REST to the control of p27 stability and cell proliferation.
22569092 role of REST in cancers
22532168 findings therefore show a critical role for the REST-LIN28A axis in tumor aggression and suggest a causative relationship between REST loss and tumorigenicity in vivo
22530801 the present study found that mutation in the REST gene rather than the NFKB1 gene was associated with the risk of CRC.
22496669 genomic motifs targeted by REST differ beween individual humans as a result of genetic polymorphisms. These polymorphic binding sites have different biochemical affinities for REST, resulting in altered in vivo transcription factor recruitment.
22419809 E1A stimulates ubiquitination and proteolysis of REST in the nucleus.
22396653 Rest has context-dependent functions for PRC1- and PRC2- recruitment, which allows this transcription factor to act both as a recruiter of Polycomb as well as a limiting factor for PRC2 recruitment at CpG islands.
22228704 a novel function of REST is to maintain self-renewal and other oncogenic properties of glioblastoma stem cells and therefore play a major role in mediating tumorigenicity in glioblastoma.
21948504 the GluR2 gene is embedded into an open chromatin configuration in glioma cells and expression of GluR2 is controlled by REST and Sp1
21921234 Repressor element 1 silencing transcription factor (REST) controls radial migration and temporal neuronal specification during neocortical development.
21832040 novel transcription regulatory mechanism of REST by HIPPI may contribute to the deregulation of transcription observed in the cell model of Huntington disease.
21536750 REST/NRSF governs the expression of dense-core vesicle gliosecretion in astrocytes
21396985 REST4 is a neuron-specific truncated form of NRSF in the brains of wild type mice; use of a transgenic Cre-loxP system disrupts neuronal expression of nrsf and its truncated forms.
21258371 These data demonstrate that HAUSP stabilizes REST through deubiquitylation and antagonizes beta-TrCP in regulating REST at the post-translational level.
21252229 the regulation of DYRK1A by REST in a negative feedback loop suggests that DYRK1A and REST are closely related in neurodevelopment.
21221247 The CoREST and REST are necessary and inimical for expression of herpes simplex virus genes.
20942606 NRSF silencing increased the transcriptional activity of the insulin gene in human amniotic fluid-derived stem cells under normal culture conditions.
20926649 Transcriptional repressor REST represses expression of mRNA levels of both potassium channel genes KCNQ2 and KCNQ3.
20697351 Our observations support the fact that NRSF/REST may act as an important modulator of malignant progression in small-cell lung cancer
20652837 Data demonstrate that NRSF and HZ4 direct overlapping as well as distinct gene expression patterns, and that they differentially modulate gene expression patterns associated with epilepsy.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624818 The concerted action of the master transcriptional factors RE1-silencing transcription factor (REST) and cAMP-response element binding protein (CREB) on miR-9-2 promoter induces miRNA expression during differentiation.
20564196 Knocking down REST expression by shRNA in the human breast cancer MCF-7 cells resulted in an increase in cell proliferation, suppression in apoptosis, and reduced sensitivity to anticancer drug
20548947 Patients with REST-less breast cancer undergo significantly more early disease recurrence than those with fully functional REST, regardless of estrogen receptor or HER2 status.
20392875 NRSF activity was required for E2 stimulation of the cell cycle.
20179156 REST is targeted to the HAR1 locus by specific DNA regulatory motifs, resulting in potent transcriptional repression.
20170730 This review presents REST as a hub that coordinates transcriptional, posttranscriptional and epigenetic programs, many of which are disrupted in Huntington's disease.
20080105 PC4 interacts with heterochromatin protein 1alpha, REST/NRSF (RE1-silencing transcription factor/neuron-restrictive silencer factor) and CoREST to establish the repressed state of neural genes in nonneuronal cells.
20011975 REST is transcriptional regulator that represses a battery of neuronal differentiation genes in non-neuronal cells. or in neural progenitor cells
19913583 PMA up-regulated hMOR transcription in PC12 cells lacking REST, and in SH-SY5Y cells either transfected with constructs deficient in the REST DNA binding element or when REST was down-regulated in retinoic acid-differentiated cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19846118 Data show reduced mRNA expression of REST in patients with major depressive disorder in a current depressive state, but not in a remissive state.
19631241 MPP(+) treatment triggered the mRNA and protein expression of NRSF and REST4, and caused both NRSF and REST4 proteins relocalized between the nucleus and cytoplasm in human dopaminergic SH-SY5Y cells.
19539370 Data show that both the TAC3 endogenous gene and its promoter are regulated, directly or indirectly, by the NRSF transcription factors resulting in both the increased expression of the endogenous gene and increased reporter gene activity.
19439607 the recovery of neurosecretion depends on the reciprocal level of BHC80 and REST, with BHC80 working as a negative modulator of REST repression
19426709 REST remotely represses activity-dependent gene transcription, the level of which controls the magnitude of the repression.
19401398 Resutls show that variations in REST binding relate directly to variations in expression and chromatin configurations of REST's target genes.
19246391 REST knockdown in low-metastatic cells and nontumorigenic cells resulted in increases in TAC1 induction, proliferation, and migration
19173732 REST-mediated chromatin remodeling is dynamic and complex, with novel histone modifying enzymes
19149626 relevant in the development of dopaminergic and peptidergic neurons from mesenchymal stem cells
19134002 the activity of the REST sites is dysfunctional in Huntington diseaes
19061646 Chromodomain on Y-like (CDYL) is identified as a REST corepressor that physically bridges REST and the histone methylase G9a to repress transcription.
18990442 The change in expression of sNRSF and TAC1 mRNA following mechanical stimulation in osteoarthritic (OA) but not normal chondrocytes suggests that sNRSF may be involved in the regulation of substance P production in OA cartilage.
18959489 REST is a transcriptional repressor of neuronal genes.
18922795 REST/NRSF, dynactin p150(Glued), huntingtin, HAP1, and RILP form a complex involved in the translocation of REST/NRSF into the nucleus and HAP1 controls REST/NRSF cellular localization in neurons
18771760 DYRK1A-mediated deregulation of REST is a very early pathological consequence of trisomy 21 with potential to disturb the development of all embryonic lineages.
18691653 This study shows REST as the limiting gene in the generation of functional mature neurons from MSCs.
18570921 Results demonstrate that NRSF silencing can activate some neuronal genes and induce neuronal differentiation of mesenchymal stem cells.
18518926 The REST haplotypes in combination with the BDNF Met66 polymorphism did not reduce cognitive performance more than the independent influence of the Met66 allele.
18518926 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18385973 critical role of REST target genes in pancreatic beta cells; evidence that the downregulation is detrimental for the exocytosis of large dense core vesicles.
18354483 REST is a key target in beta-TRCP-driven transformation and the beta-TRCP-REST axis is a new regulatory pathway controlling neurogenesis
18354482 The high levels of REST or its truncated variants found in certain human tumours may contribute to cellular transformation by promoting genomic instability.
18284609 The transcription factor REST is found to modulate transcriptional activation of mu-opioid receptor gene by insulin-like growth factor-I.
18234667 in undifferentiated human neural stem cells, neuronal genes encoding synaptic vesicle proteins are accessible for the REST mutant and are sensitive to enhanced histone acetylation
17823282 These findings show abnormal regulation of NRSF/REST as a mechanism associated with the aberrant expression of selected neuron-related proteins, which in turn accumulate in abnormal protein aggregates, in myotilinopathy.
17555596 these results suggest that REST/NRSF may have an important role in the establishment and/or maintenance of HSV-1 gene silencing during latency by targeting ICP4 expression.
17540862 sequence census method was used to map in vivo binding of the neuron-restrictive silencer factor to 1946 locations in the human genome
17468742 loss of SMCX activity impairs REST-mediated neuronal gene regulation, thereby contributing to SMCX-associated X-linked mental retardation
17023429 BRG1 facilitates REST repression by increasing the interaction between REST and chromatin
16478988 abnormal expression of REST/NRSF and MYC in undifferentiated neural stem/progenitor cells causes cerebellum-specific tumors. Furthermore, these results suggest that such a mechanism plays a role in the formation of human medulloblastoma.
16442230 Data suggest that REST/NRSF contains a NLS around ZFD-5, while the putative NLS at residues 512-522 is non-functional.
16417580 REST/NRSF-interacting LIM domain protein (RILP) is required for REST/NRSF nuclear targeting and function.
16330548 Down-regulation of NRP1 by NRSF overexpression reduced Sema3A activity. It was concluded that NRSF is a transcription factor that silences NRP1 expression and thereby diminishes the Sema3A mediated inhibition of HaCaT keratinocyte migration
16253247 HES-1 is an upstream negative regulator of REST expression.
16247481 derepression of NRSF-regulated genes including these neuron-specific genes could contribute to enhance tumorigenicity and also would provide selective markers for Brm/BRG1-deficient tumors
15767543 REST is overexpressed in human medulloblastoma tumors
15681389 results show that REST/NRSF recruits SCPs to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells
15528196 interplay between REST and Sp1 determines the cell-specific expression of REST target genes
15322094 NRSF can function as a repressor of MOR transcription in specific cells, via a mechanism dependent on the mu opioid receptor gene neuron-restrictive silencer element
15240883 individual RE1/NRSE sites interact differentially with REST/NRSF within a particular cell type.
15068239 REST-dependent proteins are comparably expressed in fetal Down syndrome (DS) and control brains by studies in the 18/19th week of gestation at the protein level; therefore, the REST-hypothesis in DS is not confirmed.
14633990 NRSF, a transcriptional repressor, selectively regulates expression of multiple fetal cardiac genes, including those for atrial natriuretic peptide, brain natriuretic peptide and alpha-skeletal actin
14565956 the transcriptional repressor NRSF/REST regulates connexin36
12829700 Regulates the expression of Pax4 protein.
12628452 Role in the regulation of cholinergic gene expression
12492469 we have identified a functional binding site for REST in the first intron of the human synaptophysin gene indicating that REST blocks human synaptophysin gene transcription through an intronic neuron-specific silencer element
12192000 role in blocking the expression of neuronal phenotypic traits in non-neuronal cells

AA Sequence

MATQVMGQSSGGGGLFTSSGNIGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEE      1 - 70
RQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVEPQPVFEASGAPDIYSSNKDL     71 - 140
PPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARESGSSTAEEGD    141 - 210
FSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCGK    211 - 280
CNYFSDRKNNYVQHVRTHTGERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRH    281 - 350
ARQVHNGPKPLNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTM    351 - 420
DVSKVKLKKTKKREADLPDNITNEKTEIEQTKIKGDVAGKKNEKSVKAEKRDVSKEKKPSNNVSVIQVTT    421 - 490
RTRKSVTEVKEMDVHTGSNSEKFSKTKKSKRKLEVDSHSLHGPVNDEESSTKKKKKVESKSKNNSQEVPK    491 - 560
GDSKVEENKKQNTCMKKSTKKKTLKNKSSKKSSKPPQKEPVEKGSAQMDPPQMGPAPTEAVQKGPVQVEP    561 - 630
PPPMEHAQMEGAQIRPAPDEPVQMEVVQEGPAQKELLPPVEPAQMVGAQIVLAHMELPPPMETAQTEVAQ    631 - 700
MGPAPMEPAQMEVAQVESAPMQVVQKEPVQMELSPPMEVVQKEPVQIELSPPMEVVQKEPVKIELSPPIE    701 - 770
VVQKEPVQMELSPPMGVVQKEPAQREPPPPREPPLHMEPISKKPPLRKDKKEKSNMQSERARKEQVLIEV    771 - 840
GLVPVKDSWLLKESVSTEDLSPPSPPLPKENLREEASGDQKLLNTGEGNKEAPLQKVGAEEADESLPGLA    841 - 910
ANINESTHISSSGQNLNTPEGETLNGKHQTDSIVCEMKMDTDQNTRENLTGINSTVEEPVSPMLPPSAVE    911 - 980
EREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSDNMSEGSDDSGLHGARPVPQESSRKNAKEA    981 - 1050
LAVKAAKGDFVCIFCDRSFRKGKDYSKHLNRHLVNVYYLEEAAQGQE                          1051 - 1097
//

Text Mined References (153)

PMID Year Title
26708060 2016 NRSF and BDNF polymorphisms as biomarkers of cognitive dysfunction in adults with newly diagnosed epilepsy.
26690059 2015 REST/NRSF Knockdown Alters Survival, Lineage Differentiation and Signaling in Human Embryonic Stem Cells.
26647819 2015 REST mediates resolution of HIF-dependent gene expression in prolonged hypoxia.
26551668 2015 Mutations in the transcriptional repressor REST predispose to Wilms tumor.
26341630 2015 RE1 silencing transcription factor (REST) negatively regulates ALL1-fused from chromosome 1q (AF1q) gene transcription.
26307266 2015 Resveratrol via sirtuin-1 downregulates RE1-silencing transcription factor (REST) expression preventing PCB-95-induced neuronal cell death.
26119235 2015 Transcriptional Mechanisms of Proneural Factors and REST in Regulating Neuronal Reprogramming of Astrocytes.
26100015 2015 Type 1 Insulin-Like Growth Factor Receptor/Insulin Receptor Substrate 1 Signaling Confers Pathogenic Activity on Breast Tumor Cells Lacking REST.
26071481 2015 SRRM4 Expression and the Loss of REST Activity May Promote the Emergence of the Neuroendocrine Phenotype in Castration-Resistant Prostate Cancer.
26003726 2015 Expression of REST4 in human gliomas in vivo and influence of pioglitazone on REST in vitro.
25990720 2015 Significant expansion of the REST/NRSF cistrome in human versus mouse embryonic stem cells: potential implications for neural development.
25613376 2015 TSPYL2 is an essential component of the REST/NRSF transcriptional complex for TGF? signaling activation.
25569790 2015 Transcriptional regulation of the neuropeptide VGF by the neuron-restrictive silencer factor/neuron-restrictive silencer element.
25559091 2015 Protective variant for hippocampal atrophy identified by whole exome sequencing.
25524378 2015 NRSF/REST regulates the mTOR signaling pathway in oral cancer cells.
25453754 2014 The oncogenic STP axis promotes triple-negative breast cancer via degradation of the REST tumor suppressor.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25424701 2015 Diagnostic significance of alternative splice variants of REST and DOPEY1 in the peripheral blood of patients with breast cancer.
25220237 2014 PDYN, a gene implicated in brain/mental disorders, is targeted by REST in the adult human brain.
25154622 2015 Characterization of a REST-Regulated Internal Promoter in the Schizophrenia Genome-Wide Associated Gene MIR137.
24740933 2014 TRF2-mediated stabilization of hREST4 is critical for the differentiation and maintenance of neural progenitors.
24670762 2014 REST and stress resistance in ageing and Alzheimer's disease.
24634989 2014 Repressor element-1 silencing transcription factor (REST) is present in human control and Huntington's disease neurones.
24415532 2014 EWS-FLI-1 regulates the neuronal repressor gene REST, which controls Ewing sarcoma growth and vascular morphology.
24235014 2013 TNFRSF10A-LOC389641 rs13278062 but not REST-C4orf14-POLR2B-IGFBP7 rs1713985 was found associated with age-related macular degeneration in a Chinese population.
24163104 2014 REST mediates androgen receptor actions on gene repression and predicts early recurrence of prostate cancer.
24135225 2014 Down-regulation of RE-1 silencing transcription factor (REST) in advanced prostate cancer by hypoxia-induced miR-106b~25.
24126098 2013 Role of NRSF/REST in the regulation of cardiac gene expression and function.
24068568 2014 The tumor suppressor microRNA, miR-124a, is regulated by epigenetic silencing and by the transcriptional factor, REST in glioblastoma.
23928058 2013 The small cell lung cancer-specific isoform of RE1-silencing transcription factor (REST) is regulated by neural-specific Ser/Arg repeat-related protein of 100 kDa (nSR100).
23651552 2013 Expression and function of the dense-core vesicle membranes are governed by the transcription repressor REST.
23614038 2013 Extensive alternative splicing of the repressor element silencing transcription factor linked to cancer.
23598529 2013 REST negatively and ISGF3 positively regulate the human STAT1 gene in melanoma.
23284171 2013 Loss of the repressor REST in uterine fibroids promotes aberrant G protein-coupled receptor 10 expression and activates mammalian target of rapamycin pathway.
23250796 2013 Specificity protein 1 (Sp1)-dependent activation of the synapsin I gene (SYN1) is modulated by RE1-silencing transcription factor (REST) and 5'-cytosine-phosphoguanine (CpG) methylation.
23238568 2013 Human oncoprotein MDM2 activates the Akt signaling pathway through an interaction with the repressor element-1 silencing transcription factor conferring a survival advantage to cancer cells.
23216891 2012 A REST derived gene signature stratifies glioblastomas into chemotherapy resistant and responsive disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23168245 2013 Neuron-restrictive silencer factor functions to suppress Sp1-mediated transactivation of human secretin receptor gene.
23151521 2013 In vivo delivery of DN:REST improves transcriptional changes of REST-regulated genes in HD mice.
23086924 2012 Neuron-restrictive silencer factor (NRSF) represses cocaine- and amphetamine-regulated transcript (CART) transcription and antagonizes cAMP-response element-binding protein signaling through a dual NRSE mechanism.
23069678 2013 NCX1 is a new rest target gene: role in cerebral ischemia.
22958208 2012 Tryptophan hydroxylase 2 (TPH2) in a neuronal cell line: modulation by cell differentiation and NRSF/rest activity.
22821339 2013 REST-dependent expression of TRF2 renders non-neuronal cancer cells resistant to DNA damage during oxidative stress.
22792276 2012 Binding of hnRNP H and U2AF65 to respective G-codes and a poly-uridine tract collaborate in the N50-5'ss selection of the REST N exon in H69 cells.
22701651 2012 REST controls self-renewal and tumorigenic competence of human glioblastoma cells.
22684772 2012 Clinical implications of REST and TUBB3 in ovarian cancer and its relationship to paclitaxel resistance.
22668508 2012 REST is up-regulated by epidermal growth factor in HeLa cells and inhibits apoptosis by influencing histone H3 acetylation.
22665064 2013 The deubiquitylase USP37 links REST to the control of p27 stability and cell proliferation.
22569092 2012 Ubiquitination and deubiquitination of REST and its roles in cancers.
22532168 2012 Induction of the RNA regulator LIN28A is required for the growth and pathogenesis of RESTless breast tumors.
22530801 2012 The joint association of REST and NFKB1 polymorphisms on the risk of colorectal cancer.
22496669 2012 A genome-wide screen for genetic variants that modify the recruitment of REST to its target genes.
22419809 2012 Transformation by E1A oncoprotein involves ubiquitin-mediated proteolysis of the neuronal and tumor repressor REST in the nucleus.
22396653 2012 REST-mediated recruitment of polycomb repressor complexes in mammalian cells.
22228704 2012 REST regulates oncogenic properties of glioblastoma stem cells.
21948504 2012 Chromatin structure and expression of the AMPA receptor subunit Glur2 in human glioma cells: major regulatory role of REST and Sp1.
21921234 2011 Repressor element 1 silencing transcription factor (REST) controls radial migration and temporal neuronal specification during neocortical development.
21909106 2011 Genome-wide association study identifies two susceptibility loci for exudative age-related macular degeneration in the Japanese population.
21832040 2011 Regulation of RE1 protein silencing transcription factor (REST) expression by HIP1 protein interactor (HIPPI).
21536750 2011 REST/NRSF governs the expression of dense-core vesicle gliosecretion in astrocytes.
21396985 2011 Ethanol-induced neurodegeneration in NRSF/REST neuronal conditional knockout mice.
21284946 2011 Zinc-finger protein 90 negatively regulates neuron-restrictive silencer factor-mediated transcriptional repression of fetal cardiac genes.
21258371 2011 Deubiquitylase HAUSP stabilizes REST and promotes maintenance of neural progenitor cells.
21252229 2011 REST regulates DYRK1A transcription in a negative feedback loop.
21221247 2010 The CoREST/REST repressor is both necessary and inimical for expression of herpes simplex virus genes.
21106707 2011 A genetic variant near the PMAIP1/Noxa gene is associated with increased bleomycin sensitivity.
20942606 2011 Neuronal restrictive silencing factor silencing induces human amniotic fluid-derived stem cells differentiation into insulin-producing cells.
20926649 2010 Transcriptional control of KCNQ channel genes and the regulation of neuronal excitability.
20697351 2010 Regulation of the NRSF/REST gene by methylation and CREB affects the cellular phenotype of small-cell lung cancer.
20652837 2011 Distinct gene expression profiles directed by the isoforms of the transcription factor neuron-restrictive silencer factor in human SK-N-AS neuroblastoma cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624818 2010 A minicircuitry involving REST and CREB controls miR-9-2 expression during human neuronal differentiation.
20564196 2010 Expression and functions of the repressor element 1 (RE-1)-silencing transcription factor (REST) in breast cancer.
20548947 2010 The transcription factor REST is lost in aggressive breast cancer.
20392875 2010 Estrogen coordinates translation and transcription, revealing a role for NRSF in human breast cancer cells.
20179156 2010 Human accelerated region 1 noncoding RNA is repressed by REST in Huntington's disease.
20170730 2010 The role of REST in transcriptional and epigenetic dysregulation in Huntington's disease.
20080105 2010 Human positive coactivator 4 controls heterochromatinization and silencing of neural gene expression by interacting with REST/NRSF and CoREST.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20011975 2009 Genome-wide identification of target genes repressed by the zinc finger transcription factor REST/NRSF in the HEK 293 cell line.
19913583 2010 Transcription factor REST negatively influences the protein kinase C-dependent up-regulation of human mu-opioid receptor gene transcription.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19846118 2010 Aberrant REST-mediated transcriptional regulation in major depressive disorder.
19631241 2009 Alteration of NRSF expression exacerbating 1-methyl-4-phenyl-pyridinium ion-induced cell death of SH-SY5Y cells.
19539370 2009 The human neurokinin B gene, TAC3, and its promoter are regulated by Neuron Restrictive Silencing Factor (NRSF) transcription factor family.
19439607 2009 The rest repression of the neurosecretory phenotype is negatively modulated by BHC80, a protein of the BRAF/HDAC complex.
19426709 2009 Remote control of activity-dependent BDNF gene promoter-I transcription mediated by REST/NRSF.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401398 2009 Functional diversity for REST (NRSF) is defined by in vivo binding affinity hierarchies at the DNA sequence level.
19342457 2009 Regulation of aldosterone and cortisol production by the transcriptional repressor neuron restrictive silencer factor.
19246391 2009 RE-1-silencing transcription factor shows tumor-suppressor functions and negatively regulates the oncogenic TAC1 in breast cancer cells.
19173732 2009 Profiling RE1/REST-mediated histone modifications in the human genome.
19149626 2009 Multi- and inter-disciplinary science in personalized delivery of stem cells for tissue repair.
19134002 2010 Analysis of the repressor element-1 silencing transcription factor/neuron-restrictive silencer factor occupancy of non-neuronal genes in peripheral lymphocytes from patients with Huntington's disease.
19061646 2008 CDYL bridges REST and histone methyltransferases for gene repression and suppression of cellular transformation.
18990442 Mechanical stimulation induces preprotachykinin gene expression in osteoarthritic chondrocytes which is correlated with modulation of the transcription factor neuron restrictive silence factor.
18959489 2008 Stem cells have different needs for REST.
18922795 2008 Huntingtin regulates RE1-silencing transcription factor/neuron-restrictive silencer factor (REST/NRSF) nuclear trafficking indirectly through a complex with REST/NRSF-interacting LIM domain protein (RILP) and dynactin p150 Glued.
18771760 2008 DYRK1A-dosage imbalance perturbs NRSF/REST levels, deregulating pluripotency and embryonic stem cell fate in Down syndrome.
18691653 2008 Loss of RE-1 silencing factor in mesenchymal stem cell-derived dopamine progenitors induces functional maturity.
18570921 2008 NRSF silencing induces neuronal differentiation of human mesenchymal stem cells.
18518926 2008 Additive effect of BDNF and REST polymorphisms is associated with improved general cognitive ability.
18385973 2008 Functional significance of repressor element 1 silencing transcription factor (REST) target genes in pancreatic beta cells.
18354483 2008 SCFbeta-TRCP controls oncogenic transformation and neural differentiation through REST degradation.
18354482 2008 Control of chromosome stability by the beta-TrCP-REST-Mad2 axis.
18284609 2008 Transcriptional activation of human mu-opioid receptor gene by insulin-like growth factor-I in neuronal cells is modulated by the transcription factor REST.
18234667 2008 Transcription of genes encoding synaptic vesicle proteins in human neural stem cells: chromatin accessibility, histone methylation pattern, and the essential role of rest.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17984088 2008 Dual role of NRSF/REST in activation and repression of the glucocorticoid response.
17823282 2007 Target genes of neuron-restrictive silencer factor are abnormally up-regulated in human myotilinopathy.
17709376 2007 Synergy between the RE-1 silencer of transcription and NFkappaB in the repression of the neurotransmitter gene TAC1 in human mesenchymal stem cells.
17555596 2007 Repressor element-1 silencing transcription factor/neuronal restrictive silencer factor (REST/NRSF) can regulate HSV-1 immediate-early transcription via histone modification.
17540862 2007 Genome-wide mapping of in vivo protein-DNA interactions.
17468742 2007 The histone H3K4 demethylase SMCX links REST target genes to X-linked mental retardation.
17130167 2006 Evidence of the neuron-restrictive silencer factor (NRSF) interaction with Sp3 and its synergic repression to the mu opioid receptor (MOR) gene.
17023429 2006 BRG1 chromatin remodeling activity is required for efficient chromatin binding by repressor element 1-silencing transcription factor (REST) and facilitates REST-mediated repression.
16478988 2006 Abnormal expression of REST/NRSF and Myc in neural stem/progenitor cells causes cerebellar tumors by blocking neuronal differentiation.
16442230 2006 Characterization of the nuclear targeting signal of REST/NRSF.
16417580 2006 Characterization of the REST/NRSF-interacting LIM domain protein (RILP): localization and interaction with REST/NRSF.
16330548 2006 Neuron restrictive silencer factor NRSF/REST is a transcriptional repressor of neuropilin-1 and diminishes the ability of semaphorin 3A to inhibit keratinocyte migration.
16288918 2005 The neural repressor NRSF/REST binds the PAH1 domain of the Sin3 corepressor by using its distinct short hydrophobic helix.
16253247 2005 The hairy and enhancer of split 1 is a negative regulator of the repressor element silencer transcription factor.
16247481 2006 SWI/SNF complex is essential for NRSF-mediated suppression of neuronal genes in human nonsmall cell lung carcinoma cell lines.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15767543 2005 Many human medulloblastoma tumors overexpress repressor element-1 silencing transcription (REST)/neuron-restrictive silencer factor, which can be functionally countered by REST-VP16.
15681389 2005 Small CTD phosphatases function in silencing neuronal gene expression.
15528196 2005 The repressor element silencing transcription factor (REST)-mediated transcriptional repression requires the inhibition of Sp1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15322094 2004 Neuron-restrictive silencer factor (NRSF) functions as a repressor in neuronal cells to regulate the mu opioid receptor gene.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15240883 2004 Genome-wide analysis of repressor element 1 silencing transcription factor/neuron-restrictive silencing factor (REST/NRSF) target genes.
15068239 2003 Transcription factor REST dependent proteins are comparable between Down syndrome and control brains: challenging a hypothesis.
15009665 2004 A restrictive element 1 (RE-1) in the VIP gene modulates transcription in neuronal and non-neuronal cells in collaboration with an upstream tissue specifier element.
14633990 2003 NRSF regulates the fetal cardiac gene program and maintains normal cardiac structure and function.
14565956 2003 Critical role of the transcriptional repressor neuron-restrictive silencer factor in the specific control of connexin36 in insulin-producing cell lines.
12881722 2003 Huntingtin interacts with REST/NRSF to modulate the transcription of NRSE-controlled neuronal genes.
12829700 2003 Regulation of Pax4 paired homeodomain gene by neuron-restrictive silencer factor.
12628452 2003 Regulation of cholinergic gene expression by the neuron restrictive silencer factor/repressor element-1 silencing transcription factor.
12492469 2003 RE-1 silencing transcription factor (REST) regulates human synaptophysin gene transcription through an intronic sequence-specific DNA-binding site.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399542 2002 Corepressor-dependent silencing of chromosomal regions encoding neuronal genes.
12192000 2002 REST repression of neuronal genes requires components of the hSWI.SNF complex.
11406295 2001 Cell-type non-selective transcription of mouse and human genes encoding neural-restrictive silencer factor.
10766169 2000 A splice variant of the neuron-restrictive silencer factor repressor is expressed in small cell lung cancer: a potential role in derepression of neuroendocrine genes and a useful clinical marker.
10734093 2000 The co-repressor mSin3A is a functional component of the REST-CoREST repressor complex.
10570134 1999 Neural restrictive silencer factor recruits mSin3 and histone deacetylase complex to repress neuron-specific target genes.
10521596 1999 Neuron-specific splicing of zinc finger transcription factor REST/NRSF/XBR is frequent in neuroblastomas and conserved in human, mouse and rat.
10449787 1999 CoREST: a functional corepressor required for regulation of neural-specific gene expression.
9756936 1998 Biological activity and modular structure of RE-1-silencing transcription factor (REST), a repressor of neuronal genes.
8568247 1996 A zinc finger protein that represses transcription of the human MHC class II gene, DPA.
7871435 1995 The neuron-restrictive silencer factor (NRSF): a coordinate repressor of multiple neuron-specific genes.
7697725 1995 REST: a mammalian silencer protein that restricts sodium channel gene expression to neurons.