Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.60
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
nephrosclerosis 1.056 7.5e-03
malignant mesothelioma -1.300 2.8e-05
astrocytic glioma -1.500 3.0e-02
ependymoma -1.900 4.6e-02
psoriasis -1.900 3.3e-06
glioblastoma multiforme -1.200 1.5e-23
osteosarcoma -3.410 7.3e-05
non diabetic and post-ischemic heart fai... 1.100 5.7e-04
atypical teratoid / rhabdoid tumor -1.500 2.3e-03
group 4 medulloblastoma -1.400 2.2e-03
medulloblastoma, large-cell -1.700 8.7e-04
primitive neuroectodermal tumor -1.200 1.0e-02
Atopic dermatitis -1.600 6.1e-03
intraductal papillary-mucinous adenoma (... -1.200 2.8e-02
intraductal papillary-mucinous carcinoma... -1.300 2.6e-02
colon cancer -1.500 8.0e-06
adult high grade glioma -1.200 9.6e-03
breast carcinoma -1.200 1.1e-18
Breast cancer -1.200 4.5e-07
ductal carcinoma in situ -2.100 1.1e-02
invasive ductal carcinoma -2.500 2.5e-02
pituitary cancer 2.100 9.4e-08

Gene RIF (1)

PMID Text
24127187 Loss of RERGL expression is associated with familial colorectal cancer.

AA Sequence

MSNFLHLKYNEKSVSVTKALTVRFLTKRFIGEYASNFESIYKKHLCLERKQLNLEIYDPCSQTQKAKFSL      1 - 70
TSELHWADGFVIVYDISDRSSFAFAKALIYRIREPQTSHCKRAVESAVFLVGNKRDLCHVREVGWEEGQK     71 - 140
LALENRCQFCELSAAEQSLEVEMMFIRIIKDILINFKLKEKRRPSGSKSMAKLINNVFGKRRKSV         141 - 205
//

Text Mined References (6)

PMID Year Title
24127187 2014 Genome-wide analysis associates familial colorectal cancer with increases in copy number variations and a rare structural variation at 12p12.3.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9628821 1998 Identification of sequence-tagged transcripts differentially expressed within the human hematopoietic hierarchy.