Property Summary

NCBI Gene PubMed Count 12
PubMed Score 36.41
PubTator Score 35.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.224 7.7e-05
psoriasis -1.800 1.7e-04
glioblastoma 1.700 5.1e-04
pediatric high grade glioma 1.100 1.7e-06
non primary Sjogren syndrome sicca 1.200 2.2e-02
ovarian cancer 2.400 4.3e-06
dermatomyositis 1.200 1.2e-03

Gene RIF (7)

PMID Text
25385046 Charcot-Marie-Tooth disease-related PMP22 is trapped in the endoplasmic reticulum by calnexin-dependent retention and Rer1-mediated early Golgi retrieval systems and partly degraded by the Hrd1-mediated endoplasmic reticulum-associated degradation system.
25096327 Rer1p regulates the ER retention of immature or misfolded rhodopsin and modulates its intracellular trafficking through the early secretory pathway.
23479743 Rer1p depletion reduced ciliary length and function by increasing gamma-secretase complex assembly and activity and, consequently, enhancing Notch signaling as well as reducing Foxj1a expression.
23129766 Synoviolin up-regulates amyloid beta production by targeting a negative regulator of gamma-secretase, Rer1, for degradation.
23043097 RER1 modulates amyloid-beta production by altering trafficking of gamma-secretase and amyloid precursor protein.
22190034 HIV-1 gp41 is identified to have a physical interaction with retention in endoplasmic reticulum 1 homolog (RER1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17668005 Downregulation of Rer1 leads to increased surface localization of Pen2, whereas overexpression of Rer1 stabilizes unassembled Pen2. Rer1 is the first identified interaction partner of mammalian transmembrane-based retention/retrieval signals.

AA Sequence

MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYA      1 - 70
LGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDA     71 - 140
FNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFAS                  141 - 196
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25385046 2014 Rer1 and calnexin regulate endoplasmic reticulum retention of a peripheral myelin protein 22 mutant that causes type 1A Charcot-Marie-Tooth disease.
25096327 2014 Rer1p regulates the ER retention of immature rhodopsin and modulates its intracellular trafficking.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23479743 2013 Rer1p maintains ciliary length and signaling by regulating ?-secretase activity and Foxj1a levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129766 2012 The ubiquitin ligase synoviolin up-regulates amyloid ? production by targeting a negative regulator of ?-secretase, Rer1, for degradation.
23043097 2012 Retention in endoplasmic reticulum 1 (RER1) modulates amyloid-? (A?) production by altering trafficking of ?-secretase and amyloid precursor protein (APP).
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17668005 2007 Endoplasmic reticulum retention of the gamma-secretase complex component Pen2 by Rer1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9309388 1997 Human Rer1 is localized to the Golgi apparatus and complements the deletion of the homologous Rer1 protein of Saccharomyces cerevisiae.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.