Property Summary

NCBI Gene PubMed Count 19
PubMed Score 32.73
PubTator Score 11.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.500 5.6e-03
ependymoma 1.600 1.4e-02
oligodendroglioma 1.700 9.3e-03
osteosarcoma -1.350 2.3e-04
atypical teratoid / rhabdoid tumor 2.100 1.6e-03
glioblastoma 2.100 6.3e-03
group 4 medulloblastoma 1.900 6.2e-03
medulloblastoma, large-cell 2.200 5.1e-06
lung cancer 1.900 2.8e-04
pediatric high grade glioma 1.500 1.3e-02
aldosterone-producing adenoma -1.184 4.6e-02
ovarian cancer 1.300 2.4e-04

Gene RIF (6)

PMID Text
26037074 Results show that breast cancer cells underwent epithelial-mesenchymal transition when AP4 was upregulated, and that AP4 regulated p53 expression level suggesting AP4 can regulate cell migration via the activity of p53.
25266805 AP4 is transcriptionally activated by TGFB1 to inhibit phosphorylation of SMAD2 as a negative regulator of an activated TGFB receptor signaling on cell growth inhibition in non-small cell lung cancer
24285725 there is a p53-induced double-negative feedback loop involving miR-15a/16-1 and AP4 that stabilizes epithelial and mesenchymal states, respectively, which may determine metastatic prowess in colorectal cancer
20727851 a potential role for Repin1 as regulator of adipocyte size was shown.Repin1 seems to be involved in the regulation of genes involved in adipogenesis.
18854154 Knockdown of replication initiator 1 (REPIN1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16924111 AP4 and geminin act as a repressor complex distinct from REST/NRSF to negatively regulate the expression of target genes in nonneuronal cells.

AA Sequence

MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWV      1 - 70
ALWLHTRRCQARLPLPCPECGRRFRHAPFLALHRQVHAAATPDLGFACHLCGQSFRGWVALVLHLRAHSA     71 - 140
AKRPIACPKCERRFWRRKQLRAHLRRCHPPAPEARPFICGNCGRSFAQWDQLVAHKRVHVAEALEEAAAK    141 - 210
ALGPRPRGRPAVTAPRPGGDAVDRPFQCACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLT    211 - 280
SHRRIHTGEKPYPCKECGRRFRHKPNLLSHSKIHKRSEGSAQAAPGPGSPQLPAGPQESAAEPTPAVPLK    281 - 350
PAQEPPPGAPPEHPQDPIEAPPSLYSCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVA    351 - 420
HSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCP    421 - 490
DCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLA    491 - 560
HQKKHDV                                                                   561 - 567
//

Text Mined References (25)

PMID Year Title
26037074 2015 AP4 activates cell migration and EMT mediated by p53 in MDA-MB-231 breast carcinoma cells.
25266805 2015 Crosstalk of AP4 and TGF? receptor signaling in NSCLC.
24285725 2014 p53-induced miR-15a/16-1 and AP4 form a double-negative feedback loop to regulate epithelial-mesenchymal transition and metastasis in colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20727851 2010 Repin1 maybe involved in the regulation of cell size and glucose transport in adipocytes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16924111 2006 A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11328883 2001 Condensation by DNA looping facilitates transfer of large DNA molecules into mammalian cells.
10606657 2000 The dhfr oribeta-binding protein RIP60 contains 15 zinc fingers: DNA binding and looping by the central three fingers and an associated proline-rich region.
8355269 1993 RIP60 dimers and multiples of dimers assemble link structures at an origin of bidirectional replication in the dihydrofolate reductase amplicon of Chinese hamster ovary cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2247056 1990 RIP60, a mammalian origin-binding protein, enhances DNA bending near the dihydrofolate reductase origin of replication.
2174103 1990 Purification of RIP60 and RIP100, mammalian proteins with origin-specific DNA-binding and ATP-dependent DNA helicase activities.