Property Summary

NCBI Gene PubMed Count 29
PubMed Score 33.72
PubTator Score 38.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cardiomyopathy, Dilated 83 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Essential Hypertension 94 3.244 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 6.0e-03
glioblastoma 1.800 4.8e-05
medulloblastoma, large-cell 1.200 2.2e-04
osteosarcoma 1.364 5.0e-04
Rheumatoid arthritis -1.700 1.3e-02
subependymal giant cell astrocytoma 1.565 1.2e-02

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MSKGLPARQDMEKERETLQAWKERVGQELDRVVAFWMEHSHDQEHGGFFTCLGREGRVYDDLKYVWLQGR      1 - 70
QVWMYCRLYRTFERFRHAQLLDAAKAGGEFLLRYARVAPPGKKCAFVLTRDGRPVKVQRTIFSECFYTMA     71 - 140
MNELWRATGEVRYQTEAVEMMDQIVHWVQEDASGLGRPQLQGAPAAEPMAVPMMLLNLVEQLGEADEELA    141 - 210
GKYAELGDWCARRILQHVQRDGQAVLENVSEGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRA    211 - 280
HVIDKFLLLPFHSGWDPDHGGLFYFQDADNFCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFY    281 - 350
QVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSRPAPAPSPAPT    351 - 420
PACRGAE                                                                   421 - 427
//

Text Mined References (31)

PMID Year Title