Property Summary

NCBI Gene PubMed Count 164
PubMed Score 620.51
PubTator Score 381.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Lissencephaly 61 5.978 3.0
Epilepsy 346 4.407 2.2
Disease Target Count
Epilepsy, familial temporal lobe, 7 1

Expression

  Differential Expression (23)

Disease log2 FC p
psoriasis -1.600 7.0e-04
astrocytoma -1.100 8.3e-13
glioblastoma -2.900 6.0e-09
oligodendroglioma -1.200 5.2e-10
group 4 medulloblastoma 2.000 1.4e-02
atypical teratoid / rhabdoid tumor -2.300 2.3e-04
pancreatic ductal adenocarcinoma liver m... -1.709 4.3e-03
intraductal papillary-mucinous adenoma (... -3.000 2.8e-04
intraductal papillary-mucinous carcinoma... -2.500 7.9e-03
intraductal papillary-mucinous neoplasm ... -3.000 5.5e-03
lung cancer -2.000 4.2e-05
colon cancer -2.100 2.2e-05
interstitial cystitis 1.700 7.8e-05
adult high grade glioma -3.200 4.2e-05
pilocytic astrocytoma -3.300 8.9e-07
posterior fossa group A ependymoma 1.600 1.5e-05
subependymal giant cell astrocytoma -4.921 9.7e-03
Breast cancer -1.100 3.7e-02
invasive ductal carcinoma -2.038 1.3e-04
lung carcinoma 3.600 8.6e-38
breast carcinoma -1.300 4.5e-23
ovarian cancer -2.200 5.7e-04
pituitary cancer -1.600 7.1e-05

Protein-protein Interaction (1)

Gene RIF (158)

PMID Text
27071537 Reelin thus plays a role in restraining RAS and PI3-kinase promotion of cell motility and potentially tumour metastasis.
26978229 The features of reelin expression in the brain of fetuses and newborns at 22-40 weeks' gestation with internal HC should be considered as morphological differential and diagnostic criteria for the disease in relation to its etiology.
26523971 These findings suggest a central AKT-FOXG1-reelin signaling pathway in focal malformations of cortical development and support pathway inhibitors as potential treatments or therapies for some forms of focal epilepsy.
26455866 rs7341475 (A/G) and rs262355 (A/T) polymorphisms in RELN gene are inversely associated with SZ risk.
26384575 Among men, but not in women certain genotypes of the RELN gene were significantly associated with the susceptibility to Alzheimer's disease.
26317415 Report demonstrated that the reelin subregion R5-6 consisting of 747 amino acids in the 5th and 6th repeats was sufficient for apoER2 and VLDLR binding, and inhibiting lipoprotein-induced cholesterol accumulation in macrophages.
26305216 the reelin protein blood concentration might be a relevant signal with respect to the pathophysiology of schizophrenia.
26270645 Study shows that early neural cells transiently express Reelin at the time they leave the presumptive olfactory/vomeronasal epithelium and that Dab 1 is present in the migratory cell mass and in the presumptive ensheathing cells in the absence of reelin.
26046367 Heterozygous reelin mutations cause autosomal-dominant lateral temporal epilepsy.
25842846 RELN gene polymorphism rs7341475 C>T is associated with the risk of paranoid schizophrenia in Russians and Tatars.
25648840 pThis study roposed that RELN mutations contribute to the genetic heterogeneity of myoclonus-dystonia.
25067827 RELN expression in the cerebral cortex of subjects with autism is not a consequence of decreased numbers of RELN-expressing neurons
24844606 The results of this study demonstrated the presence of reelin, its receptors VLDLR and ApoER2 as well as Dab1 in the ENS and might indicate a novel role of the reelin system in regulating neuronal plasticity and pre-synaptic functions in the ENS.
24803609 serum reelin may be considered an additional useful parameter for monitoring the progression of hepatic fibrosis in HCV-infected patients specially in those with active rheumatological conditions which result in an increase in serum hyaluronic acid
24643032 Lack of association for RELN is that RELN could be associated with a specific otosclerosis-like phenotype that is different from the histologically confirmed phenotype of the patients in this study.
24599114 Data indicate taht reelin interacts with amyloid beta-protein(1-42) and is sequestered by fibrils.
24453138 the RELN rs362691, rather than rs736707 or GGC repeat variant, might contribute significantly to Autism spectrum disorder risk
24384746 RELN SNPs were associated with Alzheimer disease and mild cognitive impairment. GG genotype at rs2299356 was associated with risk of AD. RELN-rs528528 CT genotype was protective for MCI.
24344333 Data suggest that PS1/gamma-secretase-dependent processing of the reelin receptor ApoER2 inhibits reelin expression and may regulate its signaling.
24252415 Results indicate that aging- and disease-associated changes in Reelin levels and proteolytic processing might play a role in the formation of corpora amylacea by altering cytoskeletal dynamics
24239537 Data indicate that Reelin is up-regulated during erythroid differentiation of erythroleukemic K562 cells.
24227897 In this population, the pathogenic link between the rs39335 variant and otosclerosis was excluded.
24170657 moderate risk of bias show a statistically significant association with the ACE gene, AGT gene, OTSC2, RELN gene, TGFB1 gene, 11q13.1, OTSC2, OTSC5, OTSC8, and OTSC10. [Review]
23951306 reelin expression is altered by Abeta leading to impaired reelin signaling.
23632168 In this review, the signaling protein Reelin, expressed along olfactory and limbic pathways is involved in the early stages of Alzheimer's disease.
23287318 The g.504742G>A polymorphic variant in the RELN gene might affect subjects susceptibility toward autism in Chinese Han population.
23277132 results of haplotype analysis might suggest a positive association between variant in RELN and schizophrenia in Chinese Va people
23274163 In human nodular heterotopia specimens, small reelin-positive cells were found in the nodules, corroborating the hypothesis that reelin might be involved in human heterotopic nodular formation.
23236151 Polyglutamine expansion decreased ATXN7 occupancy, which correlated with increased levels of histone H2B monoubiquitination, at the reelin promoter.
23216241 A significant association of intronic SNP rs736707, but not for exonci SNP rs362691, with autism in the South African population is observed.
23082219 The serine protease tissue plasminogen activator (tPA) and two matrix metalloproteinases, ADAMTS-4 and ADAMTS-5, were identified as Reelin cleaving enzymes.
22933789 The reelin pathway has a cell-autonomous and critical role in regulating dendritic development and the integration of adult-generated granule cells, via a pathway that is a key regulator of adult neurogenesis.
22797278 Since reelin is responsible for migration and synapse formation, the decreased gene expression of reelin in the left prefrontal area of schizophrenia patients points to neurodevelopmental deficits in neuronal migration and synaptic plasticity.
22614235 Reelin has a dual role in neuroblastoma Autocrine expression marks low-grade differentiating tumour cells, whereas paracrine Reelin may act as a chemoattractant and promote hematogenic and lymphogenic dissemination in progressed stages.
22495348 Decline of RELN expression in the development of Alzheimer's disease (AD) pathology supports RELN's potential as a pre-clinical marker for AD.
22419519 Variation in genes encoding proteins at the gateway of Reelin signaling: ligands RELN and APOE, their common receptors APOER2 and VLDLR, and adaptor DAB1, was examined.
22394407 show that Reelin-stimulated Notch-1 activation is dependent on Reelin signaling
22393371 Reelin is an essential negative regulator in the TGF-beta1-induced cell migration process, and is suppressed by TGF-beta pathway at the transcriptional level through Snail regulation
22203331 A subset of Focal Cortical Dysplasia type IIIa exists in which loss of Reelin appears to be the common pathogenetic basis.
22023759 the exon 22 C/G marker of Reelin is significantly associated with Alzheimer 's disease in the Greek population
22006802 The RELN promoter did not harbor risk SNPs associated with schizophrenia in the Chinese population.
22006801 Single nucleotide polymorphism of rs7341475 in intron 4 of RELN contributed to Schizophrenia susceptibility in the Chinese population.
21863557 rs362719 of the RELN gene is associated with susceptibility to schizophrenia in Chinese Han, possibly through a gender-specific mechanism.
21844191 analysis of the covalent homodimer of reelin protein linked via its central region
21814183 In mice with an overexpression of reelin protein, behavioral phenotypes related to schizophrenia and bipolar disorder are prevented.
21745129 RELN is a susceptibility gene for schizophrenia in Chinese population.
21630058 As being a part of the otic capsule, stapes footplate might be characterized by persisting reelin detectability without mRNA expression. Between these conditions, the etiologic role of RELN is questionable in the pathogenesis of otosclerosis.
21603580 study further supports the connection between RELN dysfunction and psychiatric disorders, and provides a possible functional role for a schizophrenia associated SNP.
21549172 This study describes a positive association between RELN and SZ in the Han Chinese population, and provides genetic evidence to support the gender difference of SZ.
21395570 The presence of ectopically expressed Reelin attracting migrating neurons might be a common mechanism. In patients with a genetic defect the nodular heterotopia are almost exclusively bilateral and located in the periventricular region.
21315259 Reelin regulates cadherin function via Dab1/Rap1 signal pathway to control migrating neurons and lamination in the neocortex.
20882487 Data show the lack of association between SNP rs3914132 of the RELN gene and otosclerosis in India.
20882487 Observational study of gene-disease association. (HuGE Navigator)
20847288 Data suggest that reelin may play an important role in controlling invasiveness and metastatic potential of breast cancer cells and that its expression is controlled by promoter methylation.
20734148 Reduced expression of reelin gene is associated with high recurrence rate of hepatocellular carcinoma.
20727978 Among 12 SNPs in the RELN gene, the SNPs rs2711870 and rs2249372 showed significant associations with perseverative error processing. For both SNPs, the A-alleles were related to higher numbers of perseverative errors as compared to the GG genotype.
20727978 Observational study of gene-disease association. (HuGE Navigator)
20697953 Association of exon 22 G/C marker or any marker in the vicinity, which is in linkage disequilibrium with this marker with epilepsy in the West Bengal population.
20697953 Observational study of gene-disease association. (HuGE Navigator)
20659411 Reelin levels are increased in synovial fluid of patients with rheumatoid arthritis (RA). It could play an important role in RA development and maintenance.
20642811 Four SNPs were significantly associated with otosclerosis; three SNPs are located in the RELN region and the last one is located in the region on chromosome 11.
20642811 Observational study of gene-disease association. (HuGE Navigator)
20554749 Observational study of gene-disease association. (HuGE Navigator)
20554015 The results of this study did not support previous positive findings and suggest that the four single-nucleotide polymorphisms (SNP) of RELN are unlikely to be associated with childhood autism in Chinese Han population.
20554015 Observational study of gene-disease association. (HuGE Navigator)
20468075 The association between rs7341475 and schizophrenia in women was significant (P = 9.0 x 10(-3)), with a calculated odds ratio (OR) of 1.11, and the association between rs17746501 and schizophrenia was significant in four of the new samples.
20468075 Meta-analysis of gene-disease association. (HuGE Navigator)
20452100 Reelin signaling pathways modulate phosphorylation of tau, the major component of neurofibrillary tangles, either directly or through beta-amyloid pathways that influence tau phosphorylation
20452100 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20442744 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20436377 Observational study of gene-disease association. (HuGE Navigator)
20434133 This study does not suggest a significant impact of rs7341475 on brain structure, function, and RELN expression.
20434133 Observational study of gene-disease association. (HuGE Navigator)
20431428 Association of single nucleotide polymorphism (rs7341475) in RELN with schizophrenia was replicated in women in another large independent Ashkenazi Jewish collection and confirmed that it applies to both SZ and schizoaffective disorder.
20431428 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20150511 finding suggests that lack of reelin impairs GABAergic Purkinje neuron expression and/or positioning during cerebellar development
20064940 Transgenic reelin has a direct role in promoting rapid morphological differentation and orientation of prospective layer (L6) neurons during preplate splitting.
20053715 In the absence of reelin, cortical layers fail to form due to inappropriate neuron migration and positioning in mouse chimeras.
20025970 These results provide evidence that Reelin expression and processing is altered in several amyloid conditions.
20010491 Reelin, one of the autism candidates, is necessary in regulation of neuronal migration during brain development and also in maintaining synaptic plasticity during postnatal life period
19956836 disruption of the RELN pathway may be involved in gastric carcinogenesis
19948739 Differential functions of ApoER2 and very low density lipoprotein receptor in Reelin signaling depend on differential sorting of the receptors.
19936619 These findings demonstrate for the first time that reelin is present in platelets and the reelin-to-platelet interactions play a novel role in platelet signaling and functions.
19922905 cognitive functions were detected among the affected individuals. We thus propose a particular role for RELN as a modifier gene of the pathogenesis of schizophrenia.
19922905 Observational study of gene-disease association. (HuGE Navigator)
19847460 Data further implicate RELN in the pathogenesis of otosclerosis.
19847460 Observational study of gene-disease association. (HuGE Navigator)
19720620 ApoEr2 regulates cell movement, and both X11alpha and Reelin enhance this effect.
19713529 Evidence for a role for miR-128 in neuroblastoma progression and aggressiveness through reelin and DCX expression is reported.
19691043 the Reelin gene is associated with bipolar disorder in a sex-specific manner
19691043 Observational study of gene-disease association. (HuGE Navigator)
19633980 in epilepsy reelin dysfunction causes granule cell dispersion development, and reelin is important for the maintenance of layered structures in the adult brain [review]
19436241 The genotypic distribution of reelin variant among schizoaffective disorder and bipolar disorder patients, separately in men and women, was studied.
19401682 Observational study of gene-disease association. (HuGE Navigator)
19230858 RELN is implicated in the pathogenesis of otosclerosis.
19230858 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
19054571 For reelin (RELN) an association was found for a non-synonymous polymorphism (Val997Leu) with left and right ventricular enlargement.
19054571 Observational study of gene-disease association. (HuGE Navigator)
18599960 Observational study of gene-disease association. (HuGE Navigator)
18597938 The reeln gene is no association with autism spectrum disorder in the Indian population.
18597938 Observational study of gene-disease association. (HuGE Navigator)
18593473 Both in vitro Reelin treatment and overexpression of Notch-1 intracellular domain induced BLBP expression and a radial glial phenotype in an immortalized human neural progenitor cell line, isolated from the cortex of 14 weeks old fetus
18449964 data show that Reelin's levels and glycosylation are altered in plasma from patients with cirrhosis, thereby supporting that Reelin is involved in the pathogenesis of liver disease.
18384059 Observational study of gene-disease association. (HuGE Navigator)
18282107 found a female-specific association with rs7341475, a SNP in the fourth intron of the reelin (RELN) gene (p = 2.9 x 10(-5) in women with schizophrenia), with a significant gene-sex effect (p = 1.8 x 10(-4))
18282107 Observational study of gene-disease association. (HuGE Navigator)
17955477 the possible involvement of RELN gene in the susceptibility to autistic spectrum disorder
17955477 Observational study of gene-disease association. (HuGE Navigator)
17870056 The DNA methylation status of the promoter region of RELN was examined by using the pyrosequencing method in the prefrontal cortices of 14 patients with schizophrenia and 13 control subjects.
17696989 reelin binds to apoE receptors activating the PI3 K/Akt pathway causing phosphorylation of BAD which protects cells from apoptosis
17684500 allelic variants of RELN may contribute to the endophenotypes of schizophrenia.
17684500 Observational study of gene-disease association. (HuGE Navigator)
17621165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17621165 RELN seems to be a good candidate for autism susceptibility.
17548821 Structure of a recptor-binding fragment of reelin reveals a recognition mechanism simlar to endocytic recptors.
17431900 homozygous balanced reciprocal translocations led to RELN gene inactivation
17366345 Observational study of gene-disease association. (HuGE Navigator)
17365098 The distribution of reelin in the primary visual cortex is different from other cortical areas examined; reelin is mostly present in the neurons of second and sixth layer.
17360894 Alterations in Reelin processing or signaling may be involved in Alzheimer's disease-related neuronal dysfunction.
17310238 A statistically significant correlation between the levels of DNA methylation in RELN and age was detected in healthy individuals, no such correlations were seen in either schizophrenic or bipolar patients.
16979599 our analysis produces a tentative model of the core region of the Reelin subrepeat sequences and suggests the presence in this 3D model of structural features common to polysaccharide-binding modules which are often found on proteoglycans
16951405 The effect of Dab1 on APP and apoEr2 processing in transfected cells and primary neurons is reported.
16941662 5'UTR of reelin gene may have a role in the susceptibility towards autism with the paternal transmission and non-transmission respectively of 10- and > or =11-repeat alleles, to the affected offspring.
16556465 Observational study of gene-disease association. (HuGE Navigator)
16510495 We found no difference in the expression of DISC1 or reelin mRNA in schizophrenia and no association with previously identified risk DISC1 SNPs
16481437 Reelin signals by binding to two transmembrane receptors, apolipoprotein E receptor 2 (Apoer2) and very-low-density lipoprotein receptor.
16472607 High prevalence of the silencing of RELN pathway components and its reversal by histone deacetylase inhibitors suggest the importance of this pathway as a diagnostic and therapeutic target for pancreatic cancer.
16266828 loss of Reelin results in a type of lissencephaly with severe cortical and cerebellar malformation [review]
15965968 Observational study of gene-disease association. (HuGE Navigator)
15965968 Results weakly support an association of reelin gene variants with schizophrenia as a whole, yet suggest that reelin could be associated with treatment-resistant schizophrenia.
15961543 promoter methylation is important for reduced expression of reelin in schizophrenia
15820235 The mRNAs for Reln were reduced significantly in superior frontal and cerebellar areas of autistic brains.
15718228 Dab1 regulates both cell surface expression and internalization of Reelin receptors
15690491 In the adult human neocortex, reelin-i was widespread and present in intracellular locations in cortical neuron somata and in glial cells.
15655250 In this review of the role of reelin during cerebral cortex development, specific emphasis is placed on the mechanisms by which the extracellular protein reelin regulates neuronal positioning at the end of migration.
15558079 An association analysis of five single-nucleotide polymorphisms (SNPs) of reelin (RELN) and a repeat in the 5'-untranslated region (5'-UTR) were conducted. Results strongly suggest RELN is involved in autism susceptiblity.
15464360 Reelin might be an extracellular matrix molecule involved in the terminal innervation of the dentin-pulp complex, promoting adhesion between dental nerve endings and odontoblasts.
15048648 Our interpretation of these findings is that it is unlikely that DNA variations in RELN and WNT2 play a significant role in the genetic predisposition to autism.
15048647 Our results are not consistent with a major role for Reelin alleles in liability to autism.
15006702 Reelin was detected in comparable concentrations in the CSF in children and adults, and varied largely from subject to subject with no obvious correlation with age or neurological disease state.
14515139 The analysis of RELN suggests that it probably does not play a major role in autism aetiology
12931209 Study replicates findings of increased interstitial white matter neurons (IWMNs). density, and decreased reelin expression, in schizophrenia. The loss of reelin reflects, at least partly, its decreased expression by IWMNs.
12834112 RELN and DAB1 coexpression in these neurons is necessary for both normal cortical development and mature function.
12645087 Increased levels of the 180-kDa isoform of reelin in the cerebrospinal fluid of patients with frontotemporal dementia and Alzheimer's disease suggests the involvement of reelin signaling in neurodegenerative pathologies.
12399956 case-control and affected sib-pair findings did not support a role for RELN in susceptibility to ASD, family-based association study show that RELN alleles with larger numbers of CGG repeats may affect the etiology of autism without delayed phrase speech.
12376533 reelin has a role in PI3-kinase signaling in neuronal growth cones, and in contributes to final neuron positioning in the mammalian brain by local modulation of protein kinase B and glycogen synthase kinase 3beta kinase activities
12363388 Observational study of gene-disease association. (HuGE Navigator)
12363196 We found significant reductions in 410 kDa Reelin species in autistic twins, their fathers, mothers,and phenotypically normal siblings versus controls, suggesting that Reelin 410 deficiency may be a vulnerability factor in the pathology of autism.
12192627 GGC polymorphism of the reelin gene is unlikely to be a major susceptibility factor in autism and/or genetic heterogeneity.
12122039 Decreased expression of reelin mRNA by hippocampal Cajal-Retzius cells correlates with the extent of migration defects in the dentate gyrus of patients with temporal lobe epilepsy
12082559 Observational study of gene-disease association. (HuGE Navigator)
12082559 a single nucleotide polymorphism at the 5' promoter region is associated with schizophrenia
11880184 Upregulation of reelin is associated with tumorigenesis of esophagus
11317216 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERSGWARQTFLLALLLGATLRARAAAGYYPRFSPFFFLCTHHGELEGDGEQGEVLISLHIAGNPTYYVP      1 - 70
GQEYHVTISTSTFFDGLLVTGLYTSTSVQASQSIGGSSAFGFGIMSDHQFGNQFMCSVVASHVSHLPTTN     71 - 140
LSFIWIAPPAGTGCVNFMATATHRGQVIFKDALAQQLCEQGAPTDVTVHPHLAEIHSDSIILRDDFDSYH    141 - 210
QLQLNPNIWVECNNCETGEQCGAIMHGNAVTFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRFSYSDP    211 - 280
SIIVLYAKNNSADWIQLEKIRAPSNVSTIIHILYLPEDAKGENVQFQWKQENLRVGEVYEACWALDNILI    281 - 350
INSAHRQVVLEDSLDPVDTGNWLFFPGATVKHSCQSDGNSIYFHGNEGSEFNFATTRDVDLSTEDIQEQW    351 - 420
SEEFESQPTGWDVLGAVIGTECGTIESGLSMVFLKDGERKLCTPSMDTTGYGNLRFYFVMGGICDPGNSH    421 - 490
ENDIILYAKIEGRKEHITLDTLSYSSYKVPSLVSVVINPELQTPATKFCLRQKNHQGHNRNVWAVDFFHV    491 - 560
LPVLPSTMSHMIQFSINLGCGTHQPGNSVSLEFSTNHGRSWSLLHTECLPEICAGPHLPHSTVYSSENYS    561 - 630
GWNRITIPLPNAALTRNTRIRWRQTGPILGNMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPAC    631 - 700
EMASQTFPMFISESFGSSRLSSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFL    701 - 770
QFTLRLGSKSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLSYHEPRIISVELPGDAKQFGIQFR    771 - 840
WWQPYHSSQREDVWAIDEIIMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYCGHDWTLCFTGDSKLAS    841 - 910
SMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYSTNHGLTWHLVQEECLPSMPSCQEFTSA    911 - 980
SIYHASEFTQWRRVIVLLPQKTWSSATRFRWSQSYYTAQDEWALDSIYIGQQCPNMCSGHGSCDHGICRC    981 - 1050
DQGYQGTECHPEAALPSTIMSDFENQNGWESDWQEVIGGEIVKPEQGCGVISSGSSLYFSKAGKRQLVSW   1051 - 1120
DLDTSWVDFVQFYIQIGGESASCNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAA   1121 - 1190
KTPCTRFRWWQPVFSGEDYDQWAVDDIIILSEKQKQIIPVINPTLPQNFYEKPAFDYPMNQMSVWLMLAN   1191 - 1260
EGMVKNETFCAATPSAMIFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCANQFSSTAPVLLQYSHDAGMS   1261 - 1330
WFLVKEGCYPASAGKGCEGNSRELSEPTMYHTGDFEEWTRITIVIPRSLASSKTRFRWIQESSSQKNVPP   1331 - 1400
FGLDGVYISEPCPSYCSGHGDCISGVCFCDLGYTAAQGTCVSNVPNHNEMFDRFEGKLSPLWYKITGAQV   1401 - 1470
GTGCGTLNDGKSLYFNGPGKREARTVPLDTRNIRLVQFYIQIGSKTSGITCIKPRTRNEGLIVQYSNDNG   1471 - 1540
ILWHLLRELDFMSFLEPQIISIDLPQDAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKF   1541 - 1610
DGSIDLQANWYRIQGGQVDIDCLSMDTALIFTENIGKPRYAETWDFHVSASTFLQFEMSMGCSKPFSNSH   1611 - 1680
SVQLQYSLNNGKDWHLVTEECVPPTIGCLHYTESSIYTSERFQNWKRITVYLPLSTISPRTRFRWIQANY   1681 - 1750
TVGADSWAIDNVVLASGCPWMCSGRGICDAGRCVCDRGFGGPYCVPVVPLPSILKDDFNGNLHPDLWPEV   1751 - 1820
YGAERGNLNGETIKSGTSLIFKGEGLRMLISRDLDCTNTMYVQFSLRFIAKSTPERSHSILLQFSISGGI   1821 - 1890
TWHLMDEFYFPQTTNILFINVPLPYTAQTNATRFRLWQPYNNGKKEEIWIVDDFIIDGNNVNNPVMLLDT   1891 - 1960
FDFGPREDNWFFYPGGNIGLYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLNVNENTIIQFEINVGCS   1961 - 2030
TDSSSADPVRLEFSRDFGATWHLLLPLCYHSSSHVSSLCSTEHHPSSTYYAGTMQGWRREVVHFGKLHLC   2031 - 2100
GSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCNGQGSCINGTKCICDPGYSGPTCKISTKNPDFLK   2101 - 2170
DDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLMTRDLDLSHARFVQFFMRLGCGKGVPD   2171 - 2240
PRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGRYIALEIPLKARSGSTRLRWWQPSENGHFYSPWVIDQ   2241 - 2310
ILIGGNISGNTVLEDDFTTLDSRKWLLHPGGTKMPVCGSTGDALVFIEKASTRYVVSTDVAVNEDSFLQI   2311 - 2380
DFAASCSVTDSCYAIELEYSVDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPPYTR   2381 - 2450
SQATRFRWHQPAPFDKQQTWAIDNVYIGDGCIDMCSGHGRCIQGNCVCDEQWGGLYCDDPETSLPTQLKD   2451 - 2520
NFNRAPSSQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTVDLNLTNAEFIQFYFMYGCLITPNNR   2521 - 2590
NQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNILLPPDAKEIATRFRWWQPRHDGLDQNDWAIDNVLI   2591 - 2660
SGSADQRTVMLDTFSSAPVPQHERSPADAGPVGRIAFDMFMEDKTSVNEHWLFHDDCTVERFCDSPDGVM   2661 - 2730
LCGSHDGREVYAVTHDLTPTEGWIMQFKISVGCKVSEKIAQNQIHVQYSTDFGVSWNYLVPQCLPADPKC   2731 - 2800
SGSVSQPSVFFPTKGWKRITYPLPESLVGNPVRFRFYQKYSDMQWAIDNFYLGPGCLDNCRGHGDCLREQ   2801 - 2870
CICDPGYSGPNCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAEDTALYFGGSTVRQAVTQ   2871 - 2940
DLDLRGAKFLQYWGRIGSENNMTSCHRPICRKEGVLLDYSTDGGITWTLLHEMDYQKYISVRHDYILLPE   2941 - 3010
DALTNTTRLRWWQPFVISNGIVVSGVERAQWALDNILIGGAEINPSQLVDTFDDEGTSHEENWSFYPNAV   3011 - 3080
RTAGFCGNPSFHLYWPNKKKDKTHNALSSRELIIQPGYMMQFKIVVGCEATSCGDLHSVMLEYTKDARSD   3081 - 3150
SWQLVQTQCLPSSSNSIGCSPFQFHEATIYNSVNSSSWKRITIQLPDHVSSSATQFRWIQKGEETEKQSW   3151 - 3220
AIDHVYIGEACPKLCSGHGYCTTGAICICDESFQGDDCSVFSHDLPSYIKDNFESARVTEANWETIQGGV   3221 - 3290
IGSGCGQLAPYAHGDSLYFNGCQIRQAATKPLDLTRASKIMFVLQIGSMSQTDSCNSDLSGPHAVDKAVL   3291 - 3360
LQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGTGHDQWALDHVEVVLVST   3361 - 3430
RKQNYMMNFSRQHGLRHFYNRRRRSLRRYP                                           3431 - 3460
//

Text Mined References (164)

PMID Year Title
27071537 2016 RAS signalling through PI3-Kinase controls cell migration via modulation of Reelin expression.
26978229 [Specific features of reelin expression in the brain of fetuses and newborns with internal hydrocephalus].
26523971 2015 An AKT3-FOXG1-reelin network underlies defective migration in human focal malformations of cortical development.
26455866 2015 Evaluating the relationship between reelin gene variants (rs7341475 and rs262355) and schizophrenia: A meta-analysis.
26384575 2015 Genetic analysis of the RELN gene: Gender specific association with Alzheimer's disease.
26317415 2015 A Subregion of Reelin Suppresses Lipoprotein-Induced Cholesterol Accumulation in Macrophages.
26305216 2015 Increased Blood-Reelin-Levels in First Episode Schizophrenia.
26270645 2015 Human Neural Cells Transiently Express Reelin during Olfactory Placode Development.
26046367 2015 Heterozygous reelin mutations cause autosomal-dominant lateral temporal epilepsy.
25842846 [The association of polymorphisms in SLC18A1, TPH1 and RELN genes with risk of paranoid schizophrenia].
25648840 2015 RELN rare variants in myoclonus-dystonia.
25067827 2014 RELN-expressing neuron density in layer I of the superior temporal lobe is similar in human brains with autism and in age-matched controls.
24844606 2014 Expression and regulation of reelin and its receptors in the enteric nervous system.
24803609 2014 Value of reelin for assessing hepatic fibrogenesis in a group of Egyptian HCV infected patients.
24643032 2014 Genetic association analysis in a clinically and histologically confirmed otosclerosis population confirms association with the TGFB1 gene but suggests an association of the RELN gene with a clinically indistinguishable otosclerosis-like phenotype.
24599114 2014 Reelin delays amyloid-beta fibril formation and rescues cognitive deficits in a model of Alzheimer's disease.
24453138 2014 Reelin gene variants and risk of autism spectrum disorders: an integrated meta-analysis.
24384746 Reelin signaling pathway genotypes and Alzheimer disease in a Spanish population.
24344333 2014 ApoER2 processing by presenilin-1 modulates reelin expression.
24252415 2013 Reelin immunoreactivity in neuritic varicosities in the human hippocampal formation of non-demented subjects and Alzheimer's disease patients.
24239537 2014 Erythroid differentiation is augmented in Reelin-deficient K562 cells and homozygous reeler mice.
24227897 2013 The rs39335 polymorphism of the RELN gene is not associated with otosclerosis in a southern Italian population.
24170657 2014 An introduction of genetics in otosclerosis: a systematic review.
23951306 2013 Beta-amyloid impairs reelin signaling.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23632168 2013 Decisive role of Reelin signaling during early stages of Alzheimer's disease.
23287318 RELN gene polymorphisms and susceptibility to autism in Chinese Han population.
23277132 2013 Association study of the reelin (RELN) gene with Chinese Va schizophrenia.
23274163 2012 Heterotopic reelin in human nodular heterotopia: a neuropathological study.
23236151 2012 Reelin is a target of polyglutamine expanded ataxin-7 in human spinocerebellar ataxia type 7 (SCA7) astrocytes.
23216241 2013 Association analysis of two single-nucleotide polymorphisms of the RELN gene with autism in the South African population.
23082219 2012 Regulated proteolytic processing of Reelin through interplay of tissue plasminogen activator (tPA), ADAMTS-4, ADAMTS-5, and their modulators.
22933789 2012 Cell-autonomous inactivation of the reelin pathway impairs adult neurogenesis in the hippocampus.
22797278 2012 Decreased reelin expression in the left prefrontal cortex (BA9) in chronic schizophrenia patients.
22614235 2012 Reelin signalling in neuroblastoma: migratory switch in metastatic stages.
22495348 2012 Reelin depletion is an early phenomenon of Alzheimer's pathology.
22419519 2012 Impact of the Reelin signaling cascade (ligands-receptors-adaptor complex) on cognition in schizophrenia.
22394407 2012 Reelin regulates differentiation of neural stem cells by activation of notch signaling through Disabled-1 tyrosine phosphorylation.
22393371 2012 Reelin is involved in transforming growth factor-?1-induced cell migration in esophageal carcinoma cells.
22203331 2012 Reelin: a possible link between hippocampal sclerosis and cortical dyslamination in the setting of FCD type IIIa.
22023759 The role of reelin gene polymorphisms in the pathogenesis of Alzheimer's disease in a Greek population.
22006802 2011 Association of RELN promoter SNPs with schizophrenia in the Chinese population.
22006801 2011 [Association of RELN SNP rs7341475 with schizophrenia in the Chinese population].
21863557 2011 A new single-nucleotide mutation (rs362719) of the reelin (RELN) gene associated with schizophrenia in female Chinese Han.
21844191 2011 Functional importance of covalent homodimer of reelin protein linked via its central region.
21814183 2011 Overexpression of Reelin prevents the manifestation of behavioral phenotypes related to schizophrenia and bipolar disorder.
21745129 2013 Analysis of common genetic variants identifies RELN as a risk gene for schizophrenia in Chinese population.
21630058 2012 Controversies in RELN/reelin expression in otosclerosis.
21603580 2011 The genetic variation of RELN expression in schizophrenia and bipolar disorder.
21549172 2011 Association study of RELN polymorphisms with schizophrenia in Han Chinese population.
21395570 2011 Reelin and human nodular heterotopia.
21315259 2011 Reelin regulates cadherin function via Dab1/Rap1 to control neuronal migration and lamination in the neocortex.
20882487 2010 Lack of association between SNP rs3914132 of the RELN gene and otosclerosis in India.
20847288 2010 Loss of reelin expression in breast cancer is epigenetically controlled and associated with poor prognosis.
20734148 2011 Reduced expression of reelin (RELN) gene is associated with high recurrence rate of hepatocellular carcinoma.
20727978 2010 The Reelin (RELN) gene is associated with executive function in healthy individuals.
20697953 2011 An association analysis of reelin gene (RELN) polymorphisms with childhood epilepsy in eastern Indian population from West Bengal.
20659411 Reelin levels are increased in synovial fluid of patients with rheumatoid arthritis.
20642811 2010 Genetic variants in RELN are associated with otosclerosis in a non-European population from Tunisia.
20554749 2010 FGFR2 and other loci identified in genome-wide association studies are associated with breast cancer in African-American and younger women.
20554015 2011 No significant association between RELN polymorphism and autism in case-control and family-based association study in Chinese Han population.
20468075 2010 Further investigation of the association between rs7341475 and rs17746501 and schizophrenia.
20452100 2011 Alzheimer disease pathology in cognitively healthy elderly: a genome-wide study.
20442744 2010 Linkage and candidate gene studies of autism spectrum disorders in European populations.
20436377 2010 Polymorphisms of candidate genes in Slovak autistic patients.
20434133 2010 No effect of a common allelic variant in the reelin gene on intermediate phenotype measures of brain structure, brain function, and gene expression.
20431428 2010 Replication of an association of a common variant in the Reelin gene (RELN) with schizophrenia in Ashkenazi Jewish women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20150511 2010 Lower number of cerebellar Purkinje neurons in psychosis is associated with reduced reelin expression.
20064940 2010 Reelin promotes neuronal orientation and dendritogenesis during preplate splitting.
20053715 2010 Cortical layer development and orientation is modulated by relative contributions of reelin-negative and -positive neurons in mouse chimeras.
20025970 2010 Beta-amyloid controls altered Reelin expression and processing in Alzheimer's disease.
20010491 2009 Neuroendocrine pathways altered in autism. Special role of reelin.
19956836 2010 Epigenetic silencing of RELN in gastric cancer.
19948739 2010 Differential functions of ApoER2 and very low density lipoprotein receptor in Reelin signaling depend on differential sorting of the receptors.
19936619 2010 Reelin is a platelet protein and functions as a positive regulator of platelet spreading on fibrinogen.
19922905 2010 Replication of association between working memory and Reelin, a potential modifier gene in schizophrenia.
19847460 2010 Genetic variants in the RELN gene are associated with otosclerosis in multiple European populations.
19720620 2010 The cytoplasmic adaptor protein X11alpha and extracellular matrix protein Reelin regulate ApoE receptor 2 trafficking and cell movement.
19713529 2009 MiR-128 up-regulation inhibits Reelin and DCX expression and reduces neuroblastoma cell motility and invasiveness.
19691043 2010 Sex-specific association of the Reelin gene with bipolar disorder.
19633980 2010 Reelin deficiency causes granule cell dispersion in epilepsy.
19436241 2009 A variant in the reelin gene increases the risk of schizophrenia and schizoaffective disorder but not bipolar disorder.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19230858 2009 A genome-wide analysis identifies genetic variants in the RELN gene associated with otosclerosis.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
19054571 2009 Polymorphisms in genes involved in neurodevelopment may be associated with altered brain morphology in schizophrenia: preliminary evidence.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18599960 2008 The RELN locus in Alzheimer's disease.
18597938 2008 Genetic analysis of reelin gene (RELN) SNPs: no association with autism spectrum disorder in the Indian population.
18593473 2008 Reelin induces a radial glial phenotype in human neural progenitor cells by activation of Notch-1.
18449964 2008 Reelin is overexpressed in the liver and plasma of bile duct ligated rats and its levels and glycosylation are altered in plasma of humans with cirrhosis.
18384059 2008 Association analysis of schizophrenia on 18 genes involved in neuronal migration: MDGA1 as a new susceptibility gene.
18282107 2008 Genome-wide association identifies a common variant in the reelin gene that increases the risk of schizophrenia only in women.
17955477 2008 The association analysis of RELN and GRM8 genes with autistic spectrum disorder in Chinese Han population.
17870056 2008 Methylation status of the reelin promoter region in the brain of schizophrenic patients.
17696989 2007 Reelin signals survival through Src-family kinases that inactivate BAD activity.
17684500 2008 Replication of linkage on chromosome 7q22 and association of the regional Reelin gene with working memory in schizophrenia families.
17621165 2007 Investigation of potential gene-gene interactions between APOE and RELN contributing to autism risk.
17548821 2007 Structure of a receptor-binding fragment of reelin and mutational analysis reveal a recognition mechanism similar to endocytic receptors.
17431900 2007 Identification of a novel recessive RELN mutation using a homozygous balanced reciprocal translocation.
17366345 2007 Potential genetic variants in schizophrenia: a Bayesian analysis.
17365098 2007 Reelin immunoreactivity and morphological analysis of the human visual cortex.
17360894 2007 Reelin depletion in the entorhinal cortex of human amyloid precursor protein transgenic mice and humans with Alzheimer's disease.
17310238 2007 Epigenetic aberration of the human REELIN gene in psychiatric disorders.
16979599 2006 A 3D model of Reelin subrepeat regions predicts Reelin binding to carbohydrates.
16951405 2006 DAB1 and Reelin effects on amyloid precursor protein and ApoE receptor 2 trafficking and processing.
16941662 2007 Reelin gene polymorphisms in the Indian population: a possible paternal 5'UTR-CGG-repeat-allele effect on autism.
16556465 2006 Absence of association of a polymorphic GGC repeat at the 5' untranslated region of the reelin gene with schizophrenia.
16510495 2006 Expression of DISC1 binding partners is reduced in schizophrenia and associated with DISC1 SNPs.
16481437 2006 Functional dissection of Reelin signaling by site-directed disruption of Disabled-1 adaptor binding to apolipoprotein E receptor 2: distinct roles in development and synaptic plasticity.
16472607 2006 Differential and epigenetic gene expression profiling identifies frequent disruption of the RELN pathway in pancreatic cancers.
16266828 2006 Reelin mouse mutants as models of cortical development disorders.
15965968 2005 Population-based and family-based association study of 5'UTR polymorphism of the reelin gene and schizophrenia.
15961543 2005 Reelin promoter hypermethylation in schizophrenia.
15820235 2005 Reelin signaling is impaired in autism.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15718228 2005 Disabled1 regulates the intracellular trafficking of reelin receptors.
15690491 2005 Ultrastructural localization of reelin in the cortex in post-mortem human brain.
15655250 2004 Neuronal migration and the role of reelin during early development of the cerebral cortex.
15558079 2005 Analysis of the RELN gene as a genetic risk factor for autism.
15464360 2004 Expression and localization of reelin in human odontoblasts.
15048648 2004 Lack of evidence for an association between WNT2 and RELN polymorphisms and autism.
15048647 2004 Alleles of a reelin CGG repeat do not convey liability to autism in a sample from the CPEA network.
15006702 2004 Characterization of the various forms of the Reelin protein in the cerebrospinal fluid of normal subjects and in neurological diseases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14515139 2003 Analysis of reelin as a candidate gene for autism.
12931209 2003 Interstitial white matter neurons express less reelin and are abnormally distributed in schizophrenia: towards an integration of molecular and morphologic aspects of the neurodevelopmental hypothesis.
12899622 2003 Differential binding of ligands to the apolipoprotein E receptor 2.
12853948 2003 The DNA sequence of human chromosome 7.
12834112 2003 Reelin and disabled-1 expression in developing and mature human cortical neurons.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12670700 2003 Binding of purified Reelin to ApoER2 and VLDLR mediates tyrosine phosphorylation of Disabled-1.
12645087 2003 Altered levels of cerebrospinal fluid reelin in frontotemporal dementia and Alzheimer's disease.
12399956 2002 Reelin gene alleles and susceptibility to autism spectrum disorders.
12376533 2002 Reelin-mediated signaling locally regulates protein kinase B/Akt and glycogen synthase kinase 3beta.
12363388 2002 Association analysis of polymorphic CGG repeat in 5' UTR of the reelin and VLDLR genes with schizophrenia.
12363196 2002 Reduced blood levels of reelin as a vulnerability factor in pathophysiology of autistic disorder.
12192627 2002 Absence of association between a polymorphic GGC repeat in the 5' untranslated region of the reelin gene and autism.
12167620 2002 Reelin and ApoE receptors cooperate to enhance hippocampal synaptic plasticity and learning.
12143388 2002 The surface of the developing cerebral cortex: still special cells one century later.
12135781 2002 Secreted Reelin molecules form homodimers.
12122039 2002 Role for reelin in the development of granule cell dispersion in temporal lobe epilepsy.
12087179 2002 On the epigenetic regulation of the human reelin promoter.
12082559 2002 Identification of a single nucleotide polymorphism at the 5' promoter region of human reelin gene and association study with schizophrenia.
11880184 2002 CASK and its target gene Reelin were co-upregulated in human esophageal carcinoma.
11711858 2001 Altered levels of Reelin and its isoforms in schizophrenia and mood disorders.
11689558 2002 Reelin is a serine protease of the extracellular matrix.
11520926 2001 Role of the reelin signaling pathway in central nervous system development.
11408330 2001 Persistent reelin-expressing Cajal-Retzius cells in polymicrogyria.
11317216 2001 Reelin gene alleles and haplotypes as a factor predisposing to autistic disorder.
11137154 2000 The evolution of cortical development. An hypothesis based on the role of the Reelin signaling pathway.
10973257 2000 Autosomal recessive lissencephaly with cerebellar hypoplasia is associated with human RELN mutations.
10612399 1999 Proteins of the CNR family are multiple receptors for Reelin.
10571241 1999 Direct binding of Reelin to VLDL receptor and ApoE receptor 2 induces tyrosine phosphorylation of disabled-1 and modulates tau phosphorylation.
10571240 1999 Reelin is a ligand for lipoprotein receptors.
10328932 1999 Evolutionarily conserved, alternative splicing of reelin during brain development.
9861036 1998 A decrease of reelin expression as a putative vulnerability factor in schizophrenia.
9847074 1998 Toward a complete human genome sequence.
9049633 1997 The human reelin gene: isolation, sequencing, and mapping on chromosome 7.
7715726 1995 A protein related to extracellular matrix proteins deleted in the mouse mutant reeler.