Property Summary

NCBI Gene PubMed Count 10
PubMed Score 20.26
PubTator Score 4.98

Knowledge Summary


No data available


Gene RIF (4)

22312430 a model of CagA-directed REG3gamma expression in gastric epithelial cells via activation of the IL-11/gp130/STAT3 pathway
16931762 This gene encodes a secreted peptide that displays antimicrobial activity against Gram-positive bacteria.
15777617 PAP IB represents a good example of duplication and divergence, probably with the acquisition of new functions, thus participating in the evolution of the protein repertoire.
15556304 REG III was identified and expressed predominantly in pancreas and testis, but not in small intestine

AA Sequence

LNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD                                       141 - 175

Text Mined References (12)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
22312430 2012 Helicobacter pylori CagA triggers expression of the bactericidal lectin REG3? via gastric STAT3 activation.
19095652 2009 Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment.
16931762 2006 Symbiotic bacteria direct expression of an intestinal bactericidal lectin.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15777617 2005 PAP IB, a new member of the Reg gene family: cloning, expression, structural properties, and evolution by gene duplication.
15556304 2004 Molecular cloning, expression and chromosomal localization of a novel human REG family gene, REG III.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.