Property Summary

NCBI Gene PubMed Count 43
PubMed Score 379.96
PubTator Score 1637.81

Knowledge Summary

Patent

No data available

Expression

Gene RIF (29)

PMID Text
26719042 Regulation network analysis confirmed the cell growth related differentially expressed genes, and further uncovered three transcription factor families with immune functions regulated by REG3A
26646797 Up-regulation of REG3A correlates with colorectal cancer risk.
26404002 our findings reveal a dual and contextual pathophysiologic role for REG3beta during pancreatitis and pancreatic ductal adenocarcinoma initiation
25938566 Reg3alpha is an extracellular matrix-targeted reactive oxygen species scavenger that binds the fibrin scaffold resulting from hepatocyte death during acute liver failure.
25751817 Reg3beta-dependent accumulation of macrophages in the ischemic heart has a role in myocardial healing
25112824 Serum regenerating islet-derived 3-alpha is a biomarker of mucosal enteropathies
24996521 Reg3A overexpression promoted cell growth in pancreatic cancer. SOCS3 is a key target in cancer by inhibiting cell growth and inducing apoptosis. SOCS3 negatively regulated Reg3A-mediated cell growth in pancreatic cancer.
24256734 human RegIIIalpha (also known as HIP/PAP) binds membrane phospholipids and kills bacteria by forming a hexameric membrane-permeabilizing oligomeric pore
24096422 Both live and heat-inactivated Bifidobacterium breve induced the expression of REGIII-alpha, the human ortholog and homolog of REGIII-gamma, in human colonic epithelial cells (Caco-2).
23743605 Cells transfected with REG III exhibited significantly lower cell proliferation.
23519454 Immunohistochemistry against known cell-type markers on serial sections has localised the expression of REGs to metaplastic Paneth cells (REG1A, REG1B and REG3A) and enteroendocrine cells (REG4), with a marked expansion of expression during inflammation.
23388332 The INGAP-pp may facilitate the differentiation of hUCMSCs into IPCs. However, the IPCs are not as mature as normal human islet beta cells.
22943287 HIP/PAP was abundantly expressed in bladder cancer, and the urinary levels of HIP/PAP could be a novel biomarker for detection of bladder cancer.
22727489 REG3A may mediate the epidermal hyperproliferation observed in normal wound repair and in psoriasis.
21643999 Data suggest that PAP I may contribute to endogenous protective mechanisms relevant under harmful conditions like oxidative stress, brain injury, or neurodegeneration.
20536387 The Reg3a can serve as novel target in diabetes mellitus genetic therapy.
20382864 HIP/PAP recognizes the cell wall peptidoglycan carbohydrate backbone in a calcium-independent manner via a conserved "EPN" motif that is critical for bacterial killing.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19254208 N-terminal processing is necessary for the peptidoglycan binding and bacteria-aggregating activity of PAP and that trypsin-processed and elastase-processed forms are functionally equivalent.
19158046 HIP enhanced EXTL3 translocation from the membrane to the nucleus, in support of a model whereby EXTL3 mediates HIP signaling for islet neogenesis.
19095652 antibacterial activities of mouse RegIIIgamma and its human ortholog, HIP/PAP, are tightly controlled by an inhibitory N-terminal prosegment that is removed by trypsin in vivo.
19077460 PAP diminished the expression of MMP-1 and -2 and TIMP-1 and -2 and their concentrations in pancreatic stellate cell supernatants. RECK was detected on the surface of PSCs and its expression was reduced after PAP application
19051257 PAP mRNA expression and serum PAP levels are closely related to neoplastic proliferative activity in patients with colorectal carcinoma.
17998566 Immunoreactivity to INGAP localized to the pancreatic endocrine cells in mouse. INGAP and/or related group 3 Reg proteins have a conserved expression in the pancreatic islet.
17998566 INGAP and/or related group 3 Reg proteins have a conserved expression in the pancreatic islet.
16963458 human pancreatitis-associated protein fibrillization is initiated by protein aggregation primarily because of electrostatic interactions
16931762 findings show that RegIIIgamma and its human counterpart, HIP/PAP, are directly antimicrobial proteins that bind their bacterial targets via interactions with peptidoglycan carbohydrate
16116631 In transgenic mice, HIP/PAP is a promising candidate for the prevention and treatment of liver failure.
12890698 HIP/PAP stimulates liver regeneration after partial hepatectomy and combines mitogenic and anti-apoptotic functions through the protein kinase A signaling pathway.

AA Sequence

MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQK      1 - 70
RPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTI     71 - 140
SSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD                                       141 - 175
//

Text Mined References (43)

PMID Year Title
26719042 2016 Microarray-based gene expression profiling reveals genes and pathways involved in the oncogenic function of REG3A on pancreatic cancer cells.
26646797 2016 Up-regulation of REG3A in colorectal cancer cells confers proliferation and correlates with colorectal cancer risk.
26404002 2015 IL17 Functions through the Novel REG3?-JAK2-STAT3 Inflammatory Pathway to Promote the Transition from Chronic Pancreatitis to Pancreatic Cancer.
25938566 2015 The Reg3? (HIP/PAP) Lectin Suppresses Extracellular Oxidative Stress in a Murine Model of Acute Liver Failure.
25751817 2015 Myocardial healing requires Reg3?-dependent accumulation of macrophages in the ischemic heart.
25416956 2014 A proteome-scale map of the human interactome network.
25112824 2014 Serum regenerating islet-derived 3-alpha is a biomarker of mucosal enteropathies.
24996521 2014 SOCS3 methylation in synergy with Reg3A overexpression promotes cell growth in pancreatic cancer.
24256734 2014 Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
24096422 2013 Differential induction of antimicrobial REGIII by the intestinal microbiota and Bifidobacterium breve NCC2950.
23743605 2013 Expression of REG III and prognosis in head and neck cancer.
23519454 2013 REG gene expression in inflamed and healthy colon mucosa explored by in situ hybridisation.
23388332 2013 [Role of INGAP-pp in the differentiation of hUCMSCs into insulin producing cells].
22943287 2012 Urinary levels of hepatocarcinoma-intestine-pancreas/pancreatitis-associated protein as a diagnostic biomarker in patients with bladder cancer.
22727489 2012 The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury.
21643999 2011 Expression of pancreatitis-associated protein after traumatic brain injury: a mechanism potentially contributing to neuroprotection in human brain.
20536387 2010 Isolation of genes involved in pancreas regeneration by subtractive hybridization.
20382864 2010 Molecular basis for peptidoglycan recognition by a bactericidal lectin.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19416921 2009 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.
19254208 2009 Proteolytic activation of human pancreatitis-associated protein is required for peptidoglycan binding and bacterial aggregation.
19158046 2008 Discovery of a human peptide sequence signaling islet neogenesis.
19095652 2009 Regulation of C-type lectin antimicrobial activity by a flexible N-terminal prosegment.
19077460 2009 Pancreatitis-associated protein inhibits human pancreatic stellate cell MMP-1 and -2, TIMP-1 and -2 secretion and RECK expression.
19051257 2009 Pancreatitis-associated protein is related closely to neoplastic proliferative activity in patients with colorectal carcinoma.
18192873 2008 The Reg family member INGAP is a marker of endocrine patterning in the embryonic pancreas.
17998566 2008 Pancreatic islet immunoreactivity to the Reg protein INGAP.
16963458 2006 Human pancreatitis-associated protein forms fibrillar aggregates with a native-like conformation.
16931762 2006 Symbiotic bacteria direct expression of an intestinal bactericidal lectin.
16116631 2005 HIP/PAP accelerates liver regeneration and protects against acetaminophen injury in mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12890698 2003 HIP/PAP stimulates liver regeneration after partial hepatectomy and combines mitogenic and anti-apoptotic functions through the PKA signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278730 2001 A family of 16-kDa pancreatic secretory stress proteins form highly organized fibrillar structures upon tryptic activation.
10662590 PAP I interacts with itself, PAP II, PAP III, and lithostathine/regIalpha.
9151782 1997 Cloning and sequencing of the pancreatic islet neogenesis associated protein (INGAP) gene and its expression in islet neogenesis in hamsters.
8997243 1996 HIP/PAP is an adhesive protein expressed in hepatocarcinoma, normal Paneth, and pancreatic cells.
8188210 1994 Molecular cloning, genomic organization, and chromosomal localization of the human pancreatitis-associated protein (PAP) gene.
8076648 1994 Structural organization and chromosomal localization of a human gene (HIP/PAP) encoding a C-type lectin overexpressed in primary liver cancer.
7721106 1995 The human pancreatitis-associated protein (PAP)-encoding gene generates multiple transcripts through alternative use of 5' exons.
7679928 1993 Cloning and tissue-specific expression of cDNAs for the human and mouse homologues of rat pancreatitis-associated protein (PAP).
1469087 1992 Human pancreatitis-associated protein. Messenger RNA cloning and expression in pancreatic diseases.
1325291 1992 A novel gene (HIP) activated in human primary liver cancer.