Property Summary

NCBI Gene PubMed Count 36
PubMed Score 32.11
PubTator Score 31.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P48304
Symbols REGH
REGL
PSPS2
REGI-BETA

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

PMID Text
25767811 the expression of REG Ialpha and REG Ibeta may be upregulated in human beta cells under inflammatory conditions through the JAK/STAT pathway
24007603 Additional serum biomarkers, particularly SYCN and REG1B, when combined with CA19.9, show promise as improved diagnostic indicators of pancreatic cancer, which therefore warrants further validation.
23553156 Higher REG1B stool concentrations at month 3 were significantly and independently associated with a growth shortfall in Bangladeshi and Peruvian children.
23519454 Immunohistochemistry against known cell-type markers on serial sections has localised the expression of REGs to metaplastic Paneth cells (REG1A, REG1B and REG3A) and enteroendocrine cells (REG4), with a marked expansion of expression during inflammation.
22018336 The expression of MK-1 and/or RegIV might be closely related to the carcinogenesis, clinical biological behaviors, and prognosis of gallbladder adenocarcinoma
21586335 REG 1A and REG 1B were upregulated during amebiasis and may function to protect the intestinal epithelium from parasite-induced apoptosis.
20056108 This finding suggests that REG I may act through IL-6 to exert effects on squamous esophageal cancer cell biology.
11796176 Observational study of gene-disease association. (HuGE Navigator)
11796176 did not find any association between abnormalities of either reg1 alpha or reg1 beta gene with type 1 diabetes mellitus, fibrocalculous pancreatopathy, or type 2 diabetes mellitus

AA Sequence

MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSG      1 - 70
NLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASL     71 - 140
TSCSGFKKWKDESCEKKFSFVCKFKN                                                141 - 166
//

Text Mined References (36)

PMID Year Title
25767811 2015 Synergistic activations of REG I ? and REG I ? promoters by IL-6 and Glucocorticoids through JAK/STAT pathway in human pancreatic ? cells.
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
24007603 2013 Validation of four candidate pancreatic cancer serological biomarkers that improve the performance of CA19.9.
23553156 2013 REG1B as a predictor of childhood stunting in Bangladesh and Peru.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23519454 2013 REG gene expression in inflamed and healthy colon mucosa explored by in situ hybridisation.
22018336 2011 Expression of MK-1 and RegIV and its clinicopathological significances in the benign and malignant lesions of gallbladder.
21586335 2011 The expression of REG 1A and REG 1B is increased during acute amebic colitis.
20056108 2010 Regenerating gene I regulates interleukin-6 production in squamous esophageal cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12369899 2001 Protein-X, Pancreatic Stone-, Pancreatic thread-, reg-protein, P19, lithostathine, and now what? Characterization, structural analysis and putative function(s) of the major non-enzymatic protein of pancreatic secretions.
11796176 2002 No abnormalities of reg1 alpha and reg1 beta gene associated with diabetes mellitus.
11396963 2001 Preferential expression of reg I beta gene in human adult pancreas.
10625646 2000 Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
9814489 1998 Expression of peptide-23/pancreatitis-associated protein and Reg genes in human pituitary and adenomas: comparison with other fetal and adult human tissues.
8961348 1996 What function for human lithostathine?: structural investigations by three-dimensional structure modeling and high-resolution NMR spectroscopy.
8654365 1996 Crystal structure of human lithostathine, the pancreatic inhibitor of stone formation.
8549770 1995 Human REG family genes are tandemly ordered in a 95-kilobase region of chromosome 2p12.
8348956 1993 A gene homologous to the reg gene is expressed in the human pancreas.
8333731 1993 Human regeneration protein/lithostathine genes map to chromosome 2p12.
8110835 1994 Isolation, structural determination and expression of a novel reg gene, human regI beta.
7607222 1995 The glycan moiety of human pancreatic lithostathine. Structure characterization and possible pathophysiological implications.
3908481 1985 Isolation, characterization, and distribution of an unusual pancreatic human secretory protein.
3665916 1987 Complete amino acid sequence of an immunoreactive form of human pancreatic stone protein isolated from pancreatic juice.
3541906 1986 Partial amino acid sequence of human pancreatic stone protein, a novel pancreatic secretory protein.
3108036 1987 Cleavage of the Arg-Ile bond in the native polypeptide chain of human pancreatic stone protein.
2963000 1988 A novel gene activated in regenerating islets.
2764894 1989 The human reg gene encodes pancreatic stone protein.
2525567 1989 Secretory pancreatic stone protein messenger RNA. Nucleotide sequence and expression in chronic calcifying pancreatitis.
2493268 1989 N-terminal sequence extension in the glycosylated forms of human pancreatic stone protein. The 5-oxoproline N-terminal chain is O-glycosylated on the 5th amino acid residue.
2394826 1990 Enhanced expression of an exocrine pancreatic protein in Alzheimer's disease and the developing human brain.
2332435 1990 Complete nucleotide sequence of human reg gene and its expression in normal and tumoral tissues. The reg protein, pancreatic stone protein, and pancreatic thread protein are one and the same product of the gene.
2226837 1990 Isolation and characterization of human reg protein produced in Saccharomyces cerevisiae.