Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.11
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma -1.500 3.3e-02
glioblastoma -1.100 2.3e-05
medulloblastoma -1.300 2.0e-03
medulloblastoma, large-cell -1.500 1.7e-03
primitive neuroectodermal tumor -1.400 5.4e-03
pancreatic ductal adenocarcinoma liver m... -2.527 6.6e-03
active ulcerative colitis 1.085 4.9e-02
fibroadenoma 1.200 1.1e-02
interstitial cystitis -3.000 1.5e-06
adult high grade glioma -1.300 9.0e-05
lung adenocarcinoma 2.000 7.2e-11
ductal carcinoma in situ 1.300 1.9e-02
pituitary cancer 1.700 6.3e-05

Synonym

Accession Q96HR9 B2RE01 D6W5Z0 Q96LM0
Symbols DP1L1
TB2L1
Yip2f
C19orf32

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse EggNOG Inparanoid

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19924442 DP1L1 polymorphisms are associated with colon cancer and IBD. This indicates that DP1L1 plays a functional role in these conditions. Thus DP1L1 may be a diagnostic and therapeutic target for colon cancer and IBD.
19924442 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYAS      1 - 70
IKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVV     71 - 140
RPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK                              141 - 184
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24098485 2013 REEPs are membrane shaping adapter proteins that modulate specific g protein-coupled receptor trafficking by affecting ER cargo capacity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19924442 2010 Polymorphisms of the apoptosis-associated gene DP1L1 (deleted in polyposis 1-like 1) in colon cancer and inflammatory bowel disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.