Property Summary

NCBI Gene PubMed Count 18
PubMed Score 214.57
PubTator Score 69.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Multiple myeloma 1.747 1.3e-04
malignant mesothelioma -1.200 9.6e-07
psoriasis -1.100 2.3e-04
osteosarcoma -1.323 7.4e-03
glioblastoma -1.500 1.7e-04
medulloblastoma -1.600 7.6e-07
atypical teratoid / rhabdoid tumor -1.900 4.1e-08
medulloblastoma, large-cell -2.300 2.4e-04
primitive neuroectodermal tumor -1.500 8.4e-05
pancreatic ductal adenocarcinoma liver m... -1.227 2.8e-03
non-small cell lung cancer -1.269 2.6e-23
lung cancer -1.800 2.3e-05
Breast cancer 2.400 3.0e-02
pediatric high grade glioma -1.200 7.1e-05
non primary Sjogren syndrome sicca 1.100 3.8e-02
lung adenocarcinoma -1.300 1.6e-09
Pick disease -1.300 1.3e-05
ovarian cancer -2.100 2.2e-07

Synonym

Accession Q00765 B7Z681 D3DT04 Q04198 Q5QGT0 Q9BWH9
Symbols DP1
TB2
YOP1
Yip2e
D5S346
C5orf18

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (4)

PMID Text
22795047 To determine the pathogenesis and treatment response of major depressive disorder. REEP5 gene polymorphisms may influence antidepressant treatment response in MDD.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of receptor accessory protein 5 (REEP5) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication

AA Sequence

MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYI      1 - 70
SIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRI     71 - 140
IRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST                         141 - 189
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23969831 2013 Protrudin binds atlastins and endoplasmic reticulum-shaping proteins and regulates network formation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22795047 Association of APC and REEP5 gene polymorphisms with major depression disorder and treatment response to antidepressants in a Han Chinese population.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19665976 2009 A class of dynamin-like GTPases involved in the generation of the tubular ER network.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16762630 2006 HCCR-1-interacting molecule "deleted in polyposis 1" plays a tumor-suppressor role in colon carcinogenesis.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8647449 1996 The murine homolog of TB2/DP1, a gene of the familial adenomatous polyposis (FAP) locus.
1678319 1991 Identification of deletion mutations and three new genes at the familial polyposis locus.
1659692 1991 A CA repeat 30-70 KB downstream from the adenomatous polyposis coli (APC) gene.
1651563 1991 Mutations of chromosome 5q21 genes in FAP and colorectal cancer patients.
1651562 1991 Identification of FAP locus genes from chromosome 5q21.