Property Summary

NCBI Gene PubMed Count 18
PubMed Score 219.06
PubTator Score 69.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.100 2.8e-03
atypical teratoid / rhabdoid tumor -1.900 4.1e-08
Breast cancer 2.400 3.0e-02
glioblastoma -1.200 1.1e-05
group 3 medulloblastoma -1.200 1.1e-03
lung adenocarcinoma -1.300 1.6e-09
lung cancer -1.400 1.0e-02
malignant mesothelioma -1.200 9.6e-07
medulloblastoma, large-cell -2.300 2.4e-04
Multiple myeloma 1.747 1.3e-04
non primary Sjogren syndrome sicca 1.100 3.8e-02
non-small cell lung cancer -1.269 2.6e-23
osteosarcoma 1.203 8.4e-03
ovarian cancer -2.100 2.2e-07
pancreatic ductal adenocarcinoma liver m... -1.227 2.8e-03
Pick disease -1.300 1.3e-05
primitive neuroectodermal tumor -1.500 8.4e-05
psoriasis -1.100 2.3e-04

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYI      1 - 70
SIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRI     71 - 140
IRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKST                         141 - 189
//

Text Mined References (27)

PMID Year Title