Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.30
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 4.4e-05
inflammatory breast cancer 404 8.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.099 4.4e-05
inflammatory breast cancer 1.200 8.6e-03

 GO Function (1)

Gene RIF (1)

PMID Text
23911198 Our results show that REEP3/4 function redundantly to clear the endoplasmic reticulum from metaphase chromatin, thereby ensuring correct progression through mitosis and proper nuclear envelope architecture.

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFISWFPFYYEIKM      1 - 70
AFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLSFGKRGLNIAASAAVQAATKS     71 - 140
QGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQVSHRRPPIGYRAGGLQDSDTEDECWSDTEAVPRA    141 - 210
PARPREKPLIRSQSLRVVKRKPPVREGTSRSLKVRTRKKTVPSDVDS                           211 - 257
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23911198 2013 REEP3/4 ensure endoplasmic reticulum clearance from metaphase chromatin and proper nuclear envelope architecture.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.