Tbio Receptor expression-enhancing protein 3

Add to cart

View Collections

Empty Collection

Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.

Comments

Property Summary

NCBI Gene PubMed Count	16
PubMed Score	2.17

PubTator Score	1.42

Knowledge Summary

Patent

No data available

TINX Plot

Disease (4)

Disease	Target Count	Z-score	Confidence
Autistic Disorder	364	0.0	0.0

Disease	Target Count	P-value
Astrocytoma, Pilocytic	3081	3.3e-05
ependymoma	4679	4.1e-05
primary pancreatic ductal adenocarcinoma	1109	9.5e-05
atypical teratoid / rhabdoid tumor	5112	1.0e-04
osteosarcoma	7950	1.8e-04
pancreatic cancer	2398	9.5e-04
pediatric high grade glioma	1064	1.5e-03
group 4 medulloblastoma	1855	2.9e-03
glioblastoma	5792	4.1e-03
progressive supranuclear palsy	676	1.3e-02
aldosterone-producing adenoma	665	1.5e-02
Pick disease	1894	2.1e-02
spina bifida	1074	3.7e-02

Disease	Target Count	Confidence
Juvenile rheumatoid arthritis	111	2.2
Prostate cancer	175	3.0
Type 2 diabetes mellitus	272	1.0

Disease	Target Count	Z-score	Confidence
obsessive-compulsive disorder	61	3.165	1.6

Differential Expression (13)

Disease	log2 FC	p
aldosterone-producing adenoma	-1.618	1.5e-02
Astrocytoma, Pilocytic	1.500	3.3e-05
atypical teratoid / rhabdoid tumor	2.300	1.0e-04
ependymoma	1.400	4.1e-05
glioblastoma	1.200	4.1e-03
group 4 medulloblastoma	1.500	2.9e-03
osteosarcoma	2.529	1.8e-04
pancreatic cancer	1.100	9.5e-04
pediatric high grade glioma	1.100	1.5e-03
Pick disease	-1.300	2.1e-02
primary pancreatic ductal adenocarcinoma	2.171	9.5e-05
progressive supranuclear palsy	-1.700	1.3e-02
spina bifida	-2.112	3.7e-02

Brain - Spinal cord (cervical c-1) 17,973

Cells - Transformed fibroblasts 17,577

Artery - Aorta 17,896

Artery - Tibial 17,631

Artery - Coronary 17,949

Nerve - Tibial 18,007

Lung 18,057

Brain - Cerebellar Hemisphere 18,015

Colon - Sigmoid 18,089

Brain - Cerebellum 17,983

Adipose - Visceral (Omentum) 17,937

Adipose - Subcutaneous 18,110

Uterus 17,618

Thyroid 18,024

Breast - Mammary Tissue 18,103

Esophagus - Muscularis 18,017

Esophagus - Gastroesophageal Junction 18,000

Small Intestine - Terminal Ileum 17,954

Stomach 17,879

Prostate 18,213

Vagina 17,834

Testis 18,518

Skin - Not Sun Exposed (Suprapubic) 18,081

Minor Salivary Gland 18,005

Skin - Sun Exposed (Lower leg) 17,968

Cells - EBV-transformed lymphocytes 18,186

Adrenal Gland 18,071

Colon - Transverse 17,825

Pituitary 18,147

Spleen 17,614

Ovary 17,971

Esophagus - Mucosa 18,076

Brain - Substantia nigra 17,981

Brain - Hippocampus 18,011

Brain - Hypothalamus 18,169

Liver 18,071

Heart - Atrial Appendage 17,896

Brain - Amygdala 18,006

Brain - Putamen (basal ganglia) 17,863

Brain - Caudate (basal ganglia) 18,001

Brain - Frontal Cortex (BA9) 18,069

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Cortex 18,039

Muscle - Skeletal 17,778

Brain - Anterior cingulate cortex (BA24) 17,989

Heart - Left Ventricle 18,006

Kidney - Cortex 17,329

Pancreas 18,123

Whole Blood 17,439

Adult Adrenal 8,475

Adult Ovary 10,192

Adult Liver 9,113

Adult Testis 10,836

CD8 Cells 9,840

Adult Urinary Bladder 7,592

Fetal Ovary 9,118

Adult Prostate 8,952

Fetal Gut 8,640

Adult Lung 6,663

Adult Heart 6,506

Fetal Heart 9,228

Fetal Liver 8,402

Adrenal gland

Gut

Heart

Liver

Lung

Ovary

Placenta 6,083

Prostate gland

Testis

Urinary bladder

BTO:0004410

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

heart muscle 14,972

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

Cardiovascular System 15,192

Cervical carcinoma cell 4,944

Erythroleukemia cell 4,300

Placenta 3,079

Uterus 1,493

See source...

Tailbud stage 16

See source...

Synonym

Accession	Q6NUK4 Q5JQR5 Q5QGT2 Q6PEW8 Q6PJY4
Symbols	Yip2b C10orf74

Gene

REEP3

PANTHER Protein Class (1)

transporter 580

Ortholog (12)

Species	Source	Disease
Chimp 14,136	OMA EggNOG
Mouse 16,567	Inparanoid OMA EggNOG
Macaque 12,758	Inparanoid OMA EggNOG
Dog 15,069	Inparanoid OMA EggNOG
Rat 15,112	Inparanoid OMA EggNOG
Cow 15,316	Inparanoid OMA EggNOG
Horse 14,249	Inparanoid OMA EggNOG
Chicken 7,823	Inparanoid OMA EggNOG
Opossum 12,223	Inparanoid EggNOG
Xenopus 10,463	Inparanoid OMA EggNOG
Anole lizard 10,585	Inparanoid OMA EggNOG
Zebrafish 9,725	Inparanoid OMA

UniProt Keyword (13)

Complete proteome 20,231

Polymorphism 12,194

Reference proteome 20,231

Alternative splicing 10,528

Phosphoprotein 8,216

Membrane 7,361

Transmembrane 5,228

Transmembrane helix 5,207

Cell cycle 647

Endoplasmic reticulum 1,119

See all...

GO Component (3)

integral component of membrane 3,665

endoplasmic reticulum membrane 879

microtubule 298

GO Process (3)

cell division 345

mitotic nuclear envelope reassembly 10

nuclear envelope organization 22

Compartment GO Term (32)

Cell 16,178

Cell part 16,177

Cytoplasm 10,983

Cytoplasmic part 9,247

Cytoskeletal part 1,637

Cytoskeleton 2,108

Endomembrane system 4,237

Endoplasmic reticulum 2,001

Endoplasmic reticulum membrane 1,103

Endoplasmic reticulum part 1,359

Integral component of membrane 5,331

Intracellular 14,108

Intracellular membrane-bounded organelle 10,341

Intracellular non-membrane-bounded organ... 3,975

Intracellular organelle 12,025

See all...

GWAS Trait (6)

Plasma omega-6 polyunsaturated fatty aci... 7

Intelligence (multi-trait analysis) 267

Body mass index 379

Triglyceride levels 53

Androgen levels 3

Arthritis (juvenile idiopathic) 7

HCA RNA Cell Line (56)

A-431 16,131

A549 15,174

AF22 16,160

AN3-CA 15,648

ASC TERT1 14,842

BEWO 16,726

BJ 15,448

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

BJ hTERT+ SV40 Large T+ RasG12V 15,493

See all...

Pathway (5)

Signal Transduction 2,657

GPCR downstream signalling 1,157

Signaling by GPCR 1,217

G alpha (s) signalling events 574

Olfactory Signaling Pathway 428

Gene RIF (5)

AA Sequence

MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVAWFPLYYELKI      1 - 70
AFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAATAAVTAAVKS     71 - 140
QGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDEEAEGPYS    141 - 210
DNEMLTHKGLRRSQSMKSVKTTKGRKEVRYGSLKYKVKKRPQVYF                             211 - 255
//

Text Mined References (20)

Summary
Details

	PMID	Year	Title

Tbio Receptor expression-enhancing protein 3 Add to cart View Collections Empty Collection

Property Summary

Knowledge Summary

Patent

No data available

TINX Plot

Disease (4)

Expression

Differential Expression (13)

Synonym

Gene

PANTHER Protein Class (1)

Ortholog (12)

UniProt Keyword (13)

GO Component (3)

GO Process (3)

Compartment GO Term (32)

GWAS Trait (6)

HCA RNA Cell Line (56)

Pathway (5)

Gene RIF (5)

AA Sequence

Text Mined References (20)

Tbio Receptor expression-enhancing protein 3

Add to cart

View Collections

Empty Collection