Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.82
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.700 8.8e-07
osteosarcoma 1.118 1.2e-04
breast carcinoma -1.300 3.7e-04
lung adenocarcinoma 1.200 2.6e-06
lung carcinoma 1.500 3.1e-35

Gene RIF (3)

PMID Text
24388663 We have identified mutations in REEP2 in two families with relatively pure, early-onset hereditary spastic paraplegia, one with autosomal-dominant and the other with autosomal-recessive transmission.
24355597 Expression of the REEP1/REEP2 subfamily appears to be restricted to neuronal and neuronal-like exocytotic tissues, consistent with neuronally restricted symptoms of REEP1 genetic disorders.
20943918 In mouse, Reep2 enhances sweet receptor function by a different mechanism than Reep1 uses to enhance olfactory receptor function.

AA Sequence

MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKI      1 - 70
AFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKG     71 - 140
VLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASED    141 - 210
DMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSA                                211 - 252
//

Text Mined References (17)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24388663 2014 Loss of association of REEP2 with membranes leads to hereditary spastic paraplegia.
24355597 2014 REEP1 and REEP2 proteins are preferentially expressed in neuronal and neuronal-like exocytotic tissues.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20943918 2010 REEP2 enhances sweet receptor function by recruitment to lipid rafts.
16720576 2006 Members of RTP and REEP gene families influence functional bitter taste receptor expression.
16271481 2005 Inherited ACTH insensitivity illuminates the mechanisms of ACTH action.
15550249 2004 RTP family members induce functional expression of mammalian odorant receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11161817 2001 Transcript map and comparative analysis of the 1.5-Mb commonly deleted segment of human 5q31 in malignant myeloid diseases with a del(5q).
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.