Property Summary

NCBI Gene PubMed Count 120
PubMed Score 185.25
PubTator Score 176.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.300 4.9e-06
psoriasis -1.700 2.0e-05
medulloblastoma, large-cell -1.300 4.6e-02
autosomal dominant Emery-Dreifuss muscul... 1.225 1.1e-02
Atopic dermatitis -2.200 2.9e-04
non-small cell lung cancer -1.956 4.9e-19
intraductal papillary-mucinous adenoma (... -2.900 1.9e-03
intraductal papillary-mucinous carcinoma... -3.600 8.4e-04
intraductal papillary-mucinous neoplasm ... -3.500 8.2e-03
lung cancer -2.200 5.4e-05
breast carcinoma -1.700 1.1e-24
lung adenocarcinoma -2.600 2.5e-16
Breast cancer -1.300 6.2e-05
lung carcinoma -1.100 5.7e-09
ductal carcinoma in situ -1.600 2.0e-03
invasive ductal carcinoma -2.500 7.2e-04
ovarian cancer -4.500 6.1e-14
head and neck cancer -1.500 4.8e-02

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (112)

PMID Text
26459448 RECK is a regulator of hMSC functions suggesting that modulation of RECK may improve the development of hMSC-based therapeutical approaches in regenerative medicine.
26449734 RECK is not an independent prognostic marker for breast cancer
26431549 Findings suggest that RECK transcript variants might have opposite roles in GBM biology and the ratio of their expression levels may be informative for the prognostic outcome of GBM patients.
26364844 miR-221/miR-222-RECK axis might be an important path modulating H. pylori infection-related gastric cancer development
26284486 miR-21 has a role in upregulating PTEN, RECK and PDCD4 in glioma
26261088 MMP-9/RECK imbalance in cervical smears is significantly associated with high-grade cervical diseases and infection by alpha-9 HPV and C. trachomatis.
26141647 present data indicate that there is a significant association between mutant G of rs11788747 in RECK and WT risk
26130413 This downregulation of RECK in advanced grades of osteosarcoma and metastatic grades was also associated with the increased expression of invadosome-specific markers like MMP9
26026961 A decrease in SPRY2 and RECK expression by nickel-induced miR-21 may promote invasiveness in lung cancer cells.
26026078 These findings suggest that immunohistochemical staining for RECK could be useful in the differential diagnosis between CMM and BMN.
26004948 Expression of RECK is associated with the incidence of restenosis after vascular angioplasty. RECK may be induced as a part of the intrinsic defense mechanism against restenosis.
25987077 Loss of RECK expression is associated with metastasis in Hepatoblastoma and Neuroblastoma.
25885317 RECK promoter activity is suppressed when RbAp46 binds to it and is involved in experimental lung metastasis.
25877754 D90 significantly inhibited the invasion and metastasis of OSCC cells by decreasing the expression of sp1 and increasing the expression of RECK to suppress the expression and activity of MMP-2 and MMP-9.
25845681 Notably, miR-21 regulated the potential anticancer effects of icariin on cell proliferation and apoptosis by targeting PTEN, RECK and Bcl-2 in the ovarian cancer A2780 cells
25826661 microRNA-200b and microRNA-200c promote colorectal cancer cell proliferation via targeting RECK.
25575057 MiR-25 promotes cell proliferation by targeting RECK in human cervical carcinoma.
25537516 Data show that heat shock transcription factor 1/miR-135b/reversion-inducing-cysteine-rich protein with kazal motifs and ecotropic viral integration site 5 axis provides novel insight into the mechanisms of hepatocellular carcinoma metastasis.
25516656 Suggest that upregulation of miR-374b-5p contributes to gastric cancer cell metastasis and invasion through inhibition of RECK expression.
25465153 RECK was identified as a target of miR-96 and RECK overexpression abrogates the growth of esophageal cancer cells.
25412941 Association between RECK single nucleotide polymorphism and risk of hepatocellular carcinoma in the Han Chinese population
25278269 the aim of this study was to analyze the effect of RECK gene rs 11788747 single nucleotide polymorphism (SNP) on hepatocellular carcinoma (HCC) susceptibility.
25031745 these findings suggest that dysregulations of RECK and RAGE expressions may be collectively involved in tumor progression of nasopharyngeal carcinoma by regulating MMP9 expression
24931164 RECK controls this angiogenic rheostat through a novel complex with cell surface receptors to regulate STAT3 activation
24691523 The loss of E-cadherin expression is uncoupled from RECK-upregulation in carcinoma-derived cell lines.
24647918 the data show that miR-200c expression sensitizes H460 cells to resveratrol and this is likely due to RECK expression.
24532189 demonstrate that RECK contributes to GA's anti-invasive activity and provide new evidence for GA being served as a therapeutic candidate for cancer metastasis
24510537 no association between the RECK polymorphism and chemotherapy response status in non-small-cell lung cancer in Chinese cohort
24469470 Our data suggest that miR-96 might promote the growth and motility of NSCLC cells partially by targeting RECK.
24366472 miR-96 promotes cellular proliferation, migration and invasion of MDA-MB-231 cells, at least in part, by targeting RECK.
24335752 Data indicate a consistent correlation between RECK, MT1MMP, and TIMP2 across different models of clinical samples and cell lines and suggest evidence of the potential use of this subset of genes as a gene signature for diagnosing melanoma.
24269686 Data show that miR-221 is an oncogenic miRNA which may regulate colorectal cancer (CRC) migration and invasion through targeting RECK.
24227542 There was weaker immunohistochemical expression of RECK protein in placental membranes of women with histologic chorioamnionitis compared to control subjects (P=0.0498).
24162673 MiR-92b may promote nonsmall cell lung cancer cell growth and motility partially by inhibiting RECK.
24131772 propose RECK down regulation in renal cell carcinoma to be an early event that facilitates tumor formation and progression
24078004 miR-25 might promote gastric cancer cell growth and motility partially by targeting RECK.
23881612 These results indicate that RECK represses stemness gene expression and stem-like properties by inhibiting ADAM-mediated Notch1 shedding and activation.
23820254 The STAT3-induced miR-92a promotes cancer invasion by suppressing RECK.
23749490 Data indicate that reversion-inducing-cysteine-rich protein with Kazal motifs (RECK) methylation was associated with clinical stage, histological differentiation and lymph node metastasis, but was not associated with gender, age, and tumor location.
23679328 Down-regulation of RECK expression is associated with metastasis and invasion of cervical carcinoma.
23504349 In esophageal squamous cell carcinoma miR-21 expression is increased. miR-21 down-regulation inhibits cell growth, invasion and induces cells to apoptosis by targeting FASL, TIMP3 and RECK genes.
23383207 MicroRNA-182-5p promotes cell invasion and proliferation by down regulating FOXF2, RECK and MTSS1 genes in human prostate cancer.
23333633 inverse association between miR-182 and RECK was demonstrated in breast tumor tissues
23226455 miR-182-5p plays an important role as an oncogene by knocking down RECK and Smad4, resulting in activation of the Wnt-beta-catenin signaling pathway in bladder cancer.
23189844 The level of HER-2/neu mRNA was higher and RECK mRNA was lower in breast carcinoma than homologous paraneoplastic breast tissue.
23176145 Findings indicate thet the miR-15a-RECK-matrix metalloproteinase-9 axis in neuroblastoma (NB) progression, especially in NB migration and invasion.
22844865 The conversely abnormal expression levels of MTA1 and RECK may be collectively involved in progression of malignancies and may serve as molecular predictors for metastasis, recurrence, and prognosis of nasopharyngeal carcinoma.
22761427 Keratinization-associated miR-7 and miR-21 regulate tumor suppressor reversion-inducing cysteine-rich protein with kazal motifs (RECK) in oral cancer
22630347 Knockdown of miR-21 inhibits tumor cell invasion by increasing RECK expression and decreasing tumor growth.
22438955 effect of HPV16 oncoproteins on the expression and activity of MMP-2, MMP-9, MT1-MMP, and their inhibitors TIMP-2 and RECK in cultures of keratinocytes
22428065 RECK gene polymorphisms might be a risk factor increasing HCC susceptibility and distant metastasis in Taiwan.
22419890 The results suggested that the hypermethylation may lead to promoter silencing of RECK mRNA and associated with poor survival in HCC.
22404079 RECK expression was reduced in breast carcinoma; low levels of RECK protein correlated with shorter survival in patients with breast carcinoma; low RECK expression was associated with lymph node metastasis; RECK expression is a significant prognostic factor correlated with long-term survival for patients with invasive breast cancer
22397871 decreased RECK expression was an independent prognostic factor of poor survival in colorectal cancer patients.
22338226 The well-differentiated samples showed higher expression of RECK than poorly and moderately differentiated gastric carcinoma samples.
22321642 Data suggest that H. pylori may function as an initiator in the process of carcinogenesis by up-regulating miR-222, which further participates in the progression of cancer by promoting proliferation and inhibiting RECK.
22292753 This review addresses the potential value of RECK as a prognostic marker and as a molecular target for cancer therapy. [review]
22183444 RECK was identified in endothelial cells of glioma and tended to increase toward higher grades.
22178867 RECK and MMP9 are involved in middle ear squamous cell carcinoma and may serve as markers to evaluate progression and metastasis.
22158033 These findings reveal a novel molecular pathway linking cell-cycle progression to RECK downregulation, extracellular matrix degradation and SKP2 upregulation.
22139647 TIMP-1 and RECK, are expressed in a reproducible, specific pattern and if the profiles are related to prognosis and clinical outcome in prostate cancer.
22098593 RECK intensity expression could show linear correlation with grades of glioma by the digital method, which was superior compared to the manual method
22025325 RECK is expressed in cell lines and tissue with a significant decrease in malignant tissue in prostate cancer. RECK overexpression causes an up to 80% decrease in invasion for DU-145 tumor cell line.
21949998 Aberrant expression of MTA1 and RECK gene may be involved in the invasion and metastasis of nasopharyngeal carcinoma.
21613799 Decreased RECK and increased EMMPRIN expression are associated with increasing stage and grade of urothelial carcinoma of the bladder.
21565829 results support that gene-environment interactions between the RECK polymorphisms, smoking and betel quid may alter oral cancer susceptibility and metastasis
21468925 the ERK1/2, JNK and p38 MAPK signaling pathways are involved in RECK downregulation under hypoxic conditions
21432940 Knockdown of ADRM1 in amplified ovarian cell-line OAW42 results in downregulation of growth factor GIPC1 and upregulation of tumor-suppressor RECK RNA and protein.
21254649 The expressions of RECK and RAGE in nasopharyngeal carcinoma were down-regulated.
21076843 RECK functions as a metastasis suppressor in cholangiocarcinoma
20973064 multivariate analysis confirmed that reduced RECK expression was an independent and significant factor to predict a poor prognosis in osteosarcoma.
20878580 RECK expression is low in colorectal cancer, while MMP-9 and VEGF-C expressions are high.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20579139 RECK and MMP-14 proteins may serve as markers in the estimation of the extent of metastasis and dissemination of the neuroblastoma.
20510080 The abnormal expression levels of RECK and MMP-2 may play an important role in carcinogenesis of esophageal squamous carcinoma.
20480266 miR-21 expression has a key role in regulating cellular processes in osteosarcoma, likely through regulating RECK
20407016 RECK has a role in the development of vascular endothelial cells under physiologic and pathologic (tumor angiogenesis) conditions, mainly by use of RNA interference techniques.
20395433 Data show that RECK is up-regulated in human osteoarthritic cartilage and suggest that RECK plays a role in chondrocyte cloning through suppression and promotion of chondrocyte migration and proliferation, respectively.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20154725 Hypoxia and RAS-signaling pathways converge on, and cooperatively downregulate, the RECK tumor-suppressor protein through microRNAs.
20143471 Aberrant methylation of RECK gene may provide useful information for the early diagnosis and treatment of peritoneal metastasis of gastric cancer.
20127710 This work has associated RECK tumor-suppressing activity with the inhibition of motility and invasion in this glioblastoma multiforme model.
20032402 There are differences in expression between histological types of NSCLC (SCC, adenocarcinoma). There is a higher expression of RECK in stage IA in comparison with stages IB-IIIA.
19995435 Low or no RECK expression and increased MMP-2 expression may be associated with negative clinical findings in ameloblastoma
19913121 Observational study of gene-disease association. (HuGE Navigator)
19827606 It regulates Notch signaling and its polarity mediated by ectodomain shedding of ADM10-activity-dependent DSL ligand. (review)
19208844 RECK is a glycosylphosphatidylinositol-anchored glycoprotein that inhibits the enzymatic activities of matrix metalloproteinases (MMP), thereby suppressing fibrosarcoma metastasis.
19197139 Motility, adhesion, homing, and mobilization of human hematopoietic progenitor cells are regulated in a cell-autonomous manner by dynamic and opposite changes in MT1-MMP and RECK expression.
19022775 RECK is cleaved by MMP-2 and MMP-7 and competitively inhibits MMP-7-catalyzed cleavage of fibronectin
18652766 Data suggest that RECK protein is inversely correlated with tissue damage and MMP-9 secretion in systemic lupus erythematosus.
18425389 in colorectal neoplasms, MMP-2 expression correlates with the depth of invasion, venous invasion and liver metastasis; MMP-9 and RECK expression correlate with venous invasion
18319621 Data suggest that radiation post-transciptionally enhances RECK protein levels in Panc-1 cells, at least in part, via TGF-beta signaling, and that irradiation increases Panc-1 invasiveness via a mechanism that may not be linked to MMP-2 activity.
18194466 The K23 motifs of RECK protein can inhibit MMP-9 secretion and activity and attenuate metastasis of lung cancer cells.
17714826 suppression of RECK expression is involved in the progression of adenocarcinoma of the lung
17628776 Decreased RECK expression in tumor compared with non-malignant prostate tissue.
17583418 The expression of RECK at RNA and protein levels appears to decrease in prostate cancer specimens.
17443689 epigenetic down-regulation of the metastasis suppressor RECK in colon cancer is associated with promoter methylation
17329256 RECK protein interacts with MT1-MMP and CD13/aminopeptidase N and modulates their endocytic pathways
17328864 Tgat oncoprotein is the functional inhibitor of RECK
17262820 RECK plays an important role in the invasiveness of osteosarcoma
17233834 downregulation of the metastasis suppressor RECK is caused by promoter methylation in non-small cell lung cancer
17033924 Observational study of gene-disease association. (HuGE Navigator)
17033924 The TC heterozygotes of the RECK-420 T/C SNP showed a better survival compared to the TT homozygotes (P=0.02 in all cases and P=0.03 in lymph node negative cases)
16951151 RAS oncogene induces RECK gene silencing through DNMT3b-mediated promoter methylation which may be useful in treatment of cancer metastasis
16791855 RECK downregulation is critical for the invasiveness process in glioma
16463672 RECK gene could inhibit the expression of MMP-9 in hilar cholangiocarcinomas.
16377629 HER-2/neu induces the binding of Sp proteins and HDAC1 to the RECK promoter to inhibit RECK expression and to promote cell invasion
16103099 Findings indicate that glycosylation mediates RECK suppression of tumor cell invasion by multiple mechanisms such as suppressing MMP-9 secretion and inhibiting MMP-2 activation.
15328199 RECK suppresses tumor angiogenesis/
12810630 Histone deacetylase inhibition increases RECK expression which inhibits MMP activation and cancer cell invasion. Trichostatin A up-regulated RECK via transcriptional activation in CL-1 human lung cancer cells. This attenuated MMP-2 activity.
12738734 High RECK protein is associated with invasiveness of pancreatic cancer by MMP-2 activation
12438739 Four SNPs were identified in the coding region of the gene (exons 1, 9, 13 and 15), and the remaining nine in introns 5, 8, 10, 12, 15 and 17.

AA Sequence

MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSESRLKHLLQRA      1 - 70
PDYCPETMVEIWNCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQASSKNDISKVCRKEYENALFS     71 - 140
CISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNP    141 - 210
TDSLYCCDRAEDHACQNACKRILMSKKTEMEIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPP    211 - 280
PSTGLDGAKLHCCSKANTSTCRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGC    281 - 350
RNLTYCTNFNNRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK    351 - 420
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEV    421 - 490
THPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQGCKLGEASDFIVRQGTLIQVPSSAGEVGCYKICSC    491 - 560
GQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNVCSCFAGNLVCSTRLCLSEHSSEDDRRTFTG    561 - 630
LPCNCADQFVPVCGQNGRTYPSACIARCVGLQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFD    631 - 700
KFGCSQYECVPRQLACDQVQDPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSS    701 - 770
VCAAYSDRVAVDYYGDCQAVGVLSEHSSVAECASVKCPSLLAAGCKPIIPPGACCPLCAGMLRVLFDKEK    771 - 840
LDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIEACNKEAEKIE    841 - 910
SLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVRARPSCHSLLLPLSLGLALHLLWTYN             911 - 971
//

Text Mined References (121)

PMID Year Title
26459448 2016 RECK (reversion-inducing cysteine-rich protein with Kazal motifs) regulates migration, differentiation and Wnt/?-catenin signaling in human mesenchymal stem cells.
26449734 2015 RECK is not an independent prognostic marker for breast cancer.
26431549 2015 Isolation and characterization of novel RECK tumor suppressor gene splice variants.
26364844 2015 miR-221 and miR-222 Simultaneously Target RECK and Regulate Growth and Invasion of Gastric Cancer Cells.
26284486 2015 Exosomal levels of miRNA-21 from cerebrospinal fluids associated with poor prognosis and tumor recurrence of glioma patients.
26261088 2015 MMP-9/RECK Imbalance: A Mechanism Associated with High-Grade Cervical Lesions and Genital Infection by Human Papillomavirus and Chlamydia trachomatis.
26141647 2015 RECK Gene Polymorphism is Associated with Susceptibility and Prognosis of Wilms' Tumor in Chinese Children.
26130413 2015 Promoter hypermethylation of the cysteine protease RECK may cause metastasis of osteosarcoma.
26026961 2015 Nickel may contribute to EGFR mutation and synergistically promotes tumor invasion in EGFR-mutated lung cancer via nickel-induced microRNA-21 expression.
26026078 2015 Reduced Expression of RECK Protein May Help Differentiate Cutaneous Malignant Melanoma from Melanocytic Nevus.
26004948 2015 Reversion-inducing-cysteine-rich protein with Kazal motif is involved in intimal hyperplasia in carotid arteries: a new insight in the prevention of restenosis after vascular angioplasty.
25987077 2015 Expression of RECK and MMPs in Hepatoblastoma and Neuroblastoma and Comparative Analysis on the Tumor Metastasis.
25885317 2015 Ras induces experimental lung metastasis through up-regulation of RbAp46 to suppress RECK promoter activity.
25877754 2015 Antineoplastic activity of Newcastle disease virus strain D90 in oral squamous cell carcinoma.
25845681 2015 Icariin regulates the proliferation and apoptosis of human ovarian cancer cells through microRNA-21 by targeting PTEN, RECK and Bcl-2.
25826661 2015 microRNA-200b and microRNA-200c promote colorectal cancer cell proliferation via targeting the reversion-inducing cysteine-rich protein with Kazal motifs.
25575057 2015 [miR-25 promotes cell proliferation by targeting RECK in human cervical carcinoma HeLa cells].
25537516 2015 MicroRNA-135b, a HSF1 target, promotes tumor invasion and metastasis by regulating RECK and EVI5 in hepatocellular carcinoma.
25516656 2014 MiR-374b-5p suppresses RECK expression and promotes gastric cancer cell invasion and metastasis.
25465153 2014 MiR-96 promotes proliferation and chemo- or radioresistance by down-regulating RECK in esophageal cancer.
25412941 2014 Association between polymorphisms in tumor suppressor genes and oncogenes and risk of hepatocellular carcinoma: a case-control study in an HCC epidemic area within the Han Chinese population.
25278269 2016 Reversion-Inducing-Cysteine-Rich Protein With Kazal Motifs (RECK) Gene Single Nucleotide Polymorphism With Hepatocellular Carcinoma: A Case-Control Study.
25031745 2014 Concurrent alterations of RAGE, RECK, and MMP9 protein expression are relevant to Epstein-Barr virus infection, metastasis, and survival in nasopharyngeal carcinoma.
24931164 2015 RECK controls breast cancer metastasis by modulating a convergent, STAT3-dependent neoangiogenic switch.
24691523 2014 E-cadherin-downregulation and RECK-upregulation are coupled in the non-malignant epithelial cell line MCF10A but not in multiple carcinoma-derived cell lines.
24647918 2014 Synergistic antitumor activity of resveratrol and miR-200c in human lung cancer.
24532189 2015 Involvement of RECK in gambogic acid induced anti-invasive effect in A549 human lung carcinoma cells.
24510537 2014 RECK gene polymorphisms influence NSCLC susceptibility, but not the chemotherapy response status in Chinese cohort.
24469470 2014 MiR-96 downregulates RECK to promote growth and motility of non-small cell lung cancer cells.
24366472 2014 miR-96 promotes tumor proliferation and invasion by targeting RECK in breast cancer.
24335752 2014 Downregulation of reversion-inducing cysteine-rich protein with Kazal motifs in malignant melanoma: inverse correlation with membrane-type 1-matrix metalloproteinase and tissue inhibitor of metalloproteinase 2.
24269686 2014 MicroRNA-221 promotes colorectal cancer cell invasion and metastasis by targeting RECK.
24227542 2014 Immunohistochemical expression of RECK protein in placental membranes of the preterm delivery with and without chorioamnionitis.
24162673 2014 Inhibition of miR-92b suppresses nonsmall cell lung cancer cells growth and motility by targeting RECK.
24131772 2013 Renal cell neoplasias: reversion-inducing cysteine-rich protein with Kazal motifs discriminates tumor subtypes, while extracellular matrix metalloproteinase inducer indicates prognosis.
24078004 2014 MiR-25 promotes gastric cancer cells growth and motility by targeting RECK.
23881612 2014 RECK inhibits stemness gene expression and tumorigenicity of gastric cancer cells by suppressing ADAM-mediated Notch1 activation.
23820254 2013 STAT3 upregulates miR-92a to inhibit RECK expression and to promote invasiveness of lung cancer cells.
23749490 2013 Clinical significance of RECK promoter methylation in pancreatic ductal adenocarcinoma.
23679328 2013 Expression of MiR200a, miR93, metastasis-related gene RECK and MMP2/MMP9 in human cervical carcinoma--relationship with prognosis.
23504349 2013 MiR-21 down-regulation suppresses cell growth, invasion and induces cell apoptosis by targeting FASL, TIMP3, and RECK genes in esophageal carcinoma.
23383207 2013 MicroRNA-182-5p promotes cell invasion and proliferation by down regulating FOXF2, RECK and MTSS1 genes in human prostate cancer.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23333633 2013 Up-regulation of miR-182 by ?-catenin in breast cancer increases tumorigenicity and invasiveness by targeting the matrix metalloproteinase inhibitor RECK.
23226455 2012 Oncogenic miRNA-182-5p targets Smad4 and RECK in human bladder cancer.
23189844 2012 [Expression and significance of HER-2/neu mRNA and RECK mRNA in breast carcinoma tissue].
23176145 2013 MicroRNA-15a promotes neuroblastoma migration by targeting reversion-inducing cysteine-rich protein with Kazal motifs (RECK) and regulating matrix metalloproteinase-9 expression.
22844865 2012 Aberrant expression levels of MTA1 and RECK in nasopharyngeal carcinoma: association with metastasis, recurrence, and prognosis.
22761427 2012 Keratinization-associated miR-7 and miR-21 regulate tumor suppressor reversion-inducing cysteine-rich protein with kazal motifs (RECK) in oral cancer.
22630347 2012 MicroRNA-21 expression is regulated by ?-catenin/STAT3 pathway and promotes glioma cell invasion by direct targeting RECK.
22438955 2012 HPV16 oncoproteins induce MMPs/RECK-TIMP-2 imbalance in primary keratinocytes: possible implications in cervical carcinogenesis.
22428065 2012 Effect of RECK gene polymorphisms on hepatocellular carcinoma susceptibility and clinicopathologic features.
22419890 2012 The silencing of RECK gene is associated with promoter hypermethylation and poor survival in hepatocellular carcinoma.
22404079 2012 Low expression of RECK indicates a shorter survival for patients with invasive breast cancer.
22397871 2012 Reversion-inducing cysteine-rich protein with Kazal motif (RECK) expression: an independent prognostic marker of survival in colorectal cancer.
22338226 2011 [Expression of MT1-MMP and RECK protein in human gastric carcinoma].
22321642 2012 Increased miR-222 in H. pylori-associated gastric cancer correlated with tumor progression by promoting cancer cell proliferation and targeting RECK.
22292753 2012 RECKing MMP: relevance of reversion-inducing cysteine-rich protein with kazal motifs as a prognostic marker and therapeutic target for cancer (a review).
22183444 2012 Expression of RECK in endothelial cells of glioma: comparison with CD34 and VEGF expressions.
22178867 2012 Expression of reversion-inducing cysteine-rich protein with kazal motifs and matrix metalloproteinase 9 in middle ear squamous cell carcinoma.
22158033 2012 Involvement of the SKP2-p27(KIP1) pathway in suppression of cancer cell proliferation by RECK.
22139647 MMP-9 overexpression due to TIMP-1 and RECK underexpression is associated with prognosis in prostate cancer.
22098593 2012 Comparison of manual and digital microvascular density counting of RECK expression in glioma.
22025325 2012 RECK overexpression decreases invasive potential in prostate cancer cells.
21949998 2011 [Expression and significance of MTA1 and RECK gene in nasopharyngeal carcinoma].
21613799 2011 Decreased RECK and Increased EMMPRIN expression in urothelial carcinoma of the bladder are associated with tumor aggressiveness.
21565829 2011 Impact of RECK gene polymorphisms and environmental factors on oral cancer susceptibility and clinicopathologic characteristics in Taiwan.
21468925 2011 Attenuated expression and function of the RECK tumor suppressor under hypoxic conditions is mediated by the MAPK signaling pathways.
21432940 2011 Knockdown of ovarian cancer amplification target ADRM1 leads to downregulation of GIPC1 and upregulation of RECK.
21255571 2011 The tumor suppressor RECK interferes with HER-2/Neu dimerization and attenuates its oncogenic signaling.
21254649 2010 [Expression of RECK, RAGE and MMP-9 in nasopharyngeal carcinoma and its significance].
21076843 2011 Downregulation of reversion-inducing-cysteine-rich protein with Kazal motifs (RECK) is associated with enhanced expression of matrix metalloproteinases and cholangiocarcinoma metastases.
20973064 2010 Expression of matrix metalloproteinase regulator, RECK, and its clinical significance in osteosarcoma.
20878580 2010 [Expression and significance of RECK, metalloproteinase-9 and vascular endothelial growth factor-C in colorectal cancer].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20579139 2010 Expression of the reversion-inducing cysteine-rich protein with Kazal motifs and matrix metalloproteinase-14 in neuroblastoma and the role in tumour metastasis.
20510080 2010 [Clinicopathological significance of expressions of RECK and MMP-2 in esophageal squamous carcinoma].
20480266 2011 MicroRNA-21 is involved in osteosarcoma cell invasion and migration.
20407016 2010 The ß1-integrin-dependent function of RECK in physiologic and tumor angiogenesis.
20395433 2010 RECK is up-regulated and involved in chondrocyte cloning in human osteoarthritic cartilage.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20154725 2010 Hypoxia and RAS-signaling pathways converge on, and cooperatively downregulate, the RECK tumor-suppressor protein through microRNAs.
20143471 2010 Role of RECK methylation in gastric cancer and its clinical significance.
20127710 2010 RECK-mediated inhibition of glioma migration and invasion.
20032402 2009 Significance of methylation status and the expression of RECK mRNA in lung tissue of patients with NSCLC.
19995435 2009 Expression of RECK and matrix metalloproteinase-2 in ameloblastoma.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19827606 2009 [Regulation of Notch signaling and its polarity mediated by ectodomain shedding of DSL ligands].
19208844 2009 RECK negatively regulates matrix metalloproteinase-9 transcription.
19197139 2009 MT1-MMP and RECK are involved in human CD34+ progenitor cell retention, egress, and mobilization.
19022775 2009 RECK forms cowbell-shaped dimers and inhibits matrix metalloproteinase-catalyzed cleavage of fibronectin.
18652766 Expression of reversion-inducing cysteine-rich protein with Kazal motifs in peripheral blood mononuclear cells from patients with systemic lupus erythematosus: links to disease activity, damage accrual and matrix metalloproteinase 9 secretion.
18591254 2008 MicroRNA 21 promotes glioma invasion by targeting matrix metalloproteinase regulators.
18425389 2008 Clinicopathological significance of the gene expression of matrix metalloproteinases and reversion-inducing cysteine-rich protein with Kazal motifs in patients with colorectal cancer: MMP-2 gene expression is a useful predictor of liver metastasis from colorectal cancer.
18319621 2008 Gamma-irradiation enhances RECK protein levels in Panc-1 pancreatic cancer cells.
18194466 2008 The Kazal motifs of RECK protein inhibit MMP-9 secretion and activity and reduce metastasis of lung cancer cells in vitro and in vivo.
17714826 2007 Low expression of reversion-inducing cysteine-rich protein with Kazal motifs (RECK) indicates a shorter survival after resection in patients with adenocarcinoma of the lung.
17628776 2007 [Tumor suppressor RECK in prostate carcinoma. Decreased RECK expression as indicator of proteolytic imbalance].
17583418 2007 Re: Anja Rabien, Mick Burkhardt, Monika Jung, Florian Fritzsche, Martin Ringsdorf, Hanka Schicktanz, Stefan A. Loening, Glen Kristiansen and Klaus Jung. Decreased RECK expression indicating proteolytic imbalance in prostate cancer is associated with higher tumor aggressiveness and risk of prostate-specific antigen relapse after radical prostatectomy. Eur Urol 2007;51:1259-66.
17443689 2007 Epigenetic inactivation of the metastasis suppressor RECK enhances invasion of human colon cancer cells.
17329256 2007 The reversion-inducing cysteine-rich protein with Kazal motifs (RECK) interacts with membrane type 1 matrix metalloproteinase and CD13/aminopeptidase N and modulates their endocytic pathways.
17328864 2007 Tgat oncoprotein functions as a inhibitor of RECK by association of the unique C-terminal region.
17262820 2007 RECK expression in osteosarcoma: correlation with matrix metalloproteinases activation and tumor invasiveness.
17233834 2007 Downregulation of RECK by promoter methylation correlates with lymph node metastasis in non-small cell lung cancer.
17033924 2007 Promoter polymorphisms in matrix metalloproteinases and their inhibitors: few associations with breast cancer susceptibility and progression.
16951151 2006 Silencing of the metastasis suppressor RECK by RAS oncogene is mediated by DNA methyltransferase 3b-induced promoter methylation.
16791855 2006 Downregulation of the RECK-tumor and metastasis suppressor gene in glioma invasiveness.
16463672 2005 Expression of RECK gene and MMP-9 in hilar cholangiocarcinoma and its clinical significance.
16377629 2006 HER-2/neu represses the metastasis suppressor RECK via ERK and Sp transcription factors to promote cell invasion.
16103099 2005 RECK-mediated suppression of tumor cell invasion is regulated by glycosylation in human tumor cell lines.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15328199 2004 The membrane-anchored matrix metalloproteinase (MMP) regulator RECK in combination with MMP-9 serves as an informative prognostic indicator for colorectal cancer.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12810630 2003 Histone deacetylase inhibitor up-regulates RECK to inhibit MMP-2 activation and cancer cell invasion.
12738734 2003 RECK expression in pancreatic cancer: its correlation with lower invasiveness and better prognosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438739 2002 Establishment of the genomic structure and identification of thirteen single-nucleotide polymorphisms in the human RECK gene.
11747814 2001 The membrane-anchored MMP inhibitor RECK is a key regulator of extracellular matrix integrity and angiogenesis.
9789096 1998 Measurement of the effectiveness of transitive sequence comparison, through a third 'intermediate' sequence.
9789069 1998 Regulation of matrix metalloproteinase-9 and inhibition of tumor invasion by the membrane-anchored glycoprotein RECK.