Property Summary

NCBI Gene PubMed Count 45
PubMed Score 124.76
PubTator Score 70.83

Knowledge Summary

Patent

No data available

Expression

 MGI Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (21)

AA Sequence

MWLPLLLGALLWAVLWLLRDRQSLPASNAFVFITGCDSGFGRLLALQLDQRGFRVLASCLTPSGAEDLQR      1 - 70
VASSRLHTTLLDITDPQSVQQAAKWVEMHVKEAGLFGLVNNAGVAGIIGPTPWLTRDDFQRVLNVNTMGP     71 - 140
IGVTLALLPLLQQARGRVINITSVLGRLAANGGGYCVSKFGLEAFSDSLRRDVAHFGIRVSIVEPGFFRT    141 - 210
PVTNLESLEKTLQACWARLPPATQAHYGGAFLTKYLKMQQRIMNLICDPDLTKVSRCLEHALTARHPRTR    211 - 280
YSPGWDAKLLWLPASYLPASLVDAVLTWVLPKPAQAVY                                    281 - 318
//

Text Mined References (49)

PMID Year Title