Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.06
PubTator Score 8.67

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.7e-05


  Differential Expression (1)

Disease log2 FC p
psoriasis 2.600 1.7e-05

Protein-protein Interaction (1)

Gene RIF (2)

12534290 Characterization of the retinol dehydrogenase activity of RoDH-4 identifies it as the enzyme capable of accessing the bound form of retinol for retinoic acid production.
11967490 In endometrial cancers, hRoDH-4 immunoreactivity was markedly reduced.

AA Sequence

YSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL                                     281 - 317

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
12534290 2003 Differential recognition of the free versus bound retinol by human microsomal retinol/sterol dehydrogenases: characterization of the holo-CRBP dehydrogenase activity of RoDH-4.
11967490 2002 Expression of a retinol dehydrogenase (hRoDH-4), a member of the retinol/steroid dehydrogenase family implicated in retinoic acid biosynthesis, in normal and neoplastic endometria.
11294878 2001 Characterization of a novel type of human microsomal 3alpha -hydroxysteroid dehydrogenase: unique tissue distribution and catalytic properties.
10329026 1999 Cloning and characterization of retinol dehydrogenase transcripts expressed in human epidermal keratinocytes.
9677409 1998 cDNA cloning and characterization of a new human microsomal NAD+-dependent dehydrogenase that oxidizes all-trans-retinol and 3alpha-hydroxysteroids.