Property Summary

NCBI Gene PubMed Count 22
PubMed Score 1314.80
PubTator Score 18.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.119 5.4e-03
osteosarcoma 1.150 1.3e-03
medulloblastoma, large-cell -1.200 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.681 1.1e-03
lung cancer 1.600 9.8e-04
active Crohn's disease 1.788 6.6e-03
active ulcerative colitis 1.286 1.7e-02
lung carcinoma 1.100 4.2e-18
ductal carcinoma in situ 1.100 1.2e-04

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (8)

PMID Text
25829192 Data indicate that ribosomal protein L11 (RPL11)-expressing cells proliferated more rapidly than the ribosomal protein L11 (RPL11)-expressing cells.
25542782 Data suggest that membrane anchoring of retinol dehydrogenase 11 (RDH11) is likely driven by its N-terminal segment.
24916380 deleterious mutations in RDH11, an important enzyme for vision-related and systemic retinoic acid metabolism, cause a new syndrome with RP.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of retinol dehydrogenase 11 (RDH11) expression by HIV-1 Vpr in Vpr transduced macrophages
17249616 RDH11 localizes to photoreceptor inner segments [review]
14674758 Expression pattern and high catalytic efficiency of RalR1 are consistent with the hypothesis that RalR1 contributes to the reduction of retinal in various human tissues.
12532453 The core protein of HCV can interact with translin protein. This can partly explain the molecular mechanism for hepatocellular carcinoma and lymphoma caused by HCV.
12036956 Prostate short-chain dehydrogenase/reductase (PSDR1) encodes a novel retinal reductase (RalR1).

AA Sequence

MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYL      1 - 70
ACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTAD     71 - 140
GFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANI    141 - 210
LFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILS    211 - 280
GNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID                                    281 - 318
//

Text Mined References (27)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25829192 2015 Ribosomal protein L11- and retinol dehydrogenase 11-induced erythroid proliferation without erythropoietin in UT-7/Epo erythroleukemic cells.
25542782 2015 Structure of the N-terminal segment of human retinol dehydrogenase 11 and its preferential lipid binding using model membranes.
24916380 2014 New syndrome with retinitis pigmentosa is caused by nonsense mutations in retinol dehydrogenase RDH11.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18295589 2008 In vitro and in vivo characterization of retinoid synthesis from beta-carotene.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
17249616 2006 Photoreceptor retinol dehydrogenases. An attempt to characterize the function of Rdh11.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14674758 2003 Properties of short-chain dehydrogenase/reductase RalR1: characterization of purified enzyme, its orientation in the microsomal membrane, and distribution in human tissues and cell lines.
12807874 2003 Characterization of mouse short-chain aldehyde reductase (SCALD), an enzyme regulated by sterol regulatory element-binding proteins.
12532453 2003 Interaction between hepatitis C virus core protein and translin protein--a possible molecular mechanism for hepatocellular carcinoma and lymphoma caused by hepatitis C virus.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226107 2002 Dual-substrate specificity short chain retinol dehydrogenases from the vertebrate retina.
12036956 2002 Evidence that the human gene for prostate short-chain dehydrogenase/reductase (PSDR1) encodes a novel retinal reductase (RalR1).
11245473 2001 Prostate short-chain dehydrogenase reductase 1 (PSDR1): a new member of the short-chain steroid dehydrogenase/reductase family highly expressed in normal and neoplastic prostate epithelium.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
8018917 1994 Characterization of cell phenotype by a novel cDNA library subtraction system: expression of CD8 alpha in a mast cell-derived interleukin-4-dependent cell line.