Property Summary

NCBI Gene PubMed Count 16
PubMed Score 27.50
PubTator Score 16.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma 1.100 1.4e-05
glioblastoma multiforme 2.300 1.1e-13
osteosarcoma 1.426 1.0e-02
ependymoma 1.400 9.9e-04
cystic fibrosis -2.816 8.8e-06
non diabetic and post-ischemic heart fai... -1.200 3.9e-03
type II diabetes mellitus and post-ische... -1.200 1.9e-02
atypical teratoid / rhabdoid tumor 2.100 9.6e-04
adrenocortical adenoma -1.233 1.4e-02
adrenocortical carcinoma -1.029 3.3e-02
pancreatic ductal adenocarcinoma liver m... -1.058 4.8e-02
Breast cancer 2.600 4.4e-02
adult high grade glioma 2.100 4.4e-05
group 4 medulloblastoma 1.600 7.3e-04
pilocytic astrocytoma 1.800 3.7e-06
aldosterone-producing adenoma -1.684 4.2e-02
nasopharyngeal carcinoma -1.200 3.2e-02
lung carcinoma -1.600 3.3e-14
spina bifida -1.819 3.0e-02
ovarian cancer -2.500 4.6e-05
pituitary cancer -4.100 6.8e-08

Protein-protein Interaction (1)

Gene RIF (9)

PMID Text
25627686 Insulin inhibits retinoic acid biosynthesis through inhibition of FoxO1-induced Rdh10 gene expression.
24733397 Data indicate that retinaldehyde reductase (DHRS3) requires retinol dehydrogenase 10 (RDH10) for full enzymatic activity and, in turn, activates RDH10.
23833249 all three proteins (RDH10, RALDH2, and CRABP2) appeared to be required for ATRA production induced by activation of PPARgamma
21345790 Retinol dehydrogenase 10 but not retinol/sterol dehydrogenase(s) regulates the expression of retinoic acid-responsive genes in human transgenic skin raft culture.
19473719 CYP4Z1, KIR and RDH10 could play a role in non-small-cell lung cancer progression
19102727 wild-type RDH10 catalysed both oxidation of all-trans-retinol and reduction of all-trans-retinal in a cofactor-dependent manner In vitro, however, oxidation is the favoured reaction catalysed by RDH10
18502750 dual physiological role for RDH10: in the biosynthesis of 11-cis-retinaldehyde for vision as well as the biosynthesis of all-trans-retinoic acid for differentiation and development
17218779 Forced over-expression of the RDH10 gene causes growth arrest of HepG2 cells and could be a possible curative strategy for hepatocellular carcinoma.
14596915 organization of the gene includes a unique transcriptional start site, a coding region with six translated exons and a 3' UTR containing at least two used polyadenylation sites.

AA Sequence

MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINT      1 - 70
QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVS     71 - 140
VLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDY    141 - 210
CASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAI    211 - 280
LTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI             281 - 341
//

Text Mined References (17)

PMID Year Title
25627686 2015 Insulin regulates retinol dehydrogenase expression and all-trans-retinoic acid biosynthesis through FoxO1.
24733397 2014 The retinaldehyde reductase activity of DHRS3 is reciprocally activated by retinol dehydrogenase 10 to control retinoid homeostasis.
23833249 2013 RDH10, RALDH2, and CRABP2 are required components of PPAR?-directed ATRA synthesis and signaling in human dendritic cells.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21345790 2011 Retinol dehydrogenase 10 but not retinol/sterol dehydrogenase(s) regulates the expression of retinoic acid-responsive genes in human transgenic skin raft culture.
19473719 2010 Identification of genes associated with non-small-cell lung cancer promotion and progression.
19458327 2009 The 11-cis-retinol dehydrogenase activity of RDH10 and its interaction with visual cycle proteins.
19102727 2009 Characterization of key residues and membrane association domains in retinol dehydrogenase 10.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18502750 2008 Kinetic analysis of human enzyme RDH10 defines the characteristics of a physiologically relevant retinol dehydrogenase.
17218779 2007 Forced expression of RDH10 gene retards growth of HepG2 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14596915 2003 Genomic organization and transcription of the human retinol dehydrogenase 10 (RDH10) gene.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12407145 2002 Cloning and characterization of a novel all-trans retinol short-chain dehydrogenase/reductase from the RPE.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.