Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.97
PubTator Score 3.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -3.275 5.0e-07
glioblastoma 1.200 1.2e-02
periodontitis 1.100 1.9e-26
adrenocortical carcinoma -1.070 5.3e-03
tuberculosis 1.200 5.7e-06
non-small cell lung cancer -1.726 3.4e-17
interstitial cystitis 1.200 2.7e-02
pediatric high grade glioma 1.200 1.8e-03
pilocytic astrocytoma 1.700 4.2e-07
primary Sjogren syndrome 2.300 1.3e-04
subependymal giant cell astrocytoma 1.492 3.1e-02
invasive ductal carcinoma 1.097 5.7e-03
Breast cancer -1.900 4.4e-08
ulcerative colitis 1.900 3.6e-03
ovarian cancer -1.200 2.0e-04

Synonym

Accession Q6JBY9 B1AK48 Q4G0E7 Q6IN93 Q8IZM2 Q96DX0 Q9NST4
Symbols MK2S4
CAPZIP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)
17541395 CapZIP is fused to ABL1 in a t(1;9)(q24;q34)-associated B-cell acute lymphoblastic leukemia
15850461 The structure and function of CapZ-interacting protein are reported.

AA Sequence

MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSLPLFPPKVDLGQNGEEKSPP      1 - 70
NASHPPKFKVKSSPLIEKLQANLTFDPAALLPGASPKSPGLKAMVSPFHSPPSTPSSPGVRSRPSEAEEV     71 - 140
PVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSDCGELGDFRAVESSQQNGAKEEDGDEVLPSK    141 - 210
SKAPGSPLSSEGAAGEGVRTLGPAEKPPLRRSPSRTEKQEEDRATEEAKNGEKARRSSEEVDGQHPAQEE    211 - 280
VPESPQTSGPEAENRCGSPREEKPAGEEAEMEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPH    281 - 350
SPPGGVKGGDVPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM        351 - 416
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
17541395 2007 A new partner gene fused to ABL1 in a t(1;9)(q24;q34)-associated B-cell acute lymphoblastic leukemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15850461 2005 The phosphorylation of CapZ-interacting protein (CapZIP) by stress-activated protein kinases triggers its dissociation from CapZ.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.