Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.97
PubTator Score 3.99

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.070 5.3e-03
adult high grade glioma 1.100 2.5e-02
Astrocytoma, Pilocytic 1.600 7.9e-07
Breast cancer -1.900 4.4e-08
glioblastoma 1.100 1.8e-04
interstitial cystitis 1.200 2.7e-02
invasive ductal carcinoma 1.097 5.7e-03
non-small cell lung cancer -1.726 3.4e-17
osteosarcoma -2.462 4.6e-04
ovarian cancer -1.200 2.0e-04
periodontitis 1.100 1.9e-26
primary Sjogren syndrome 2.300 1.3e-04
subependymal giant cell astrocytoma 1.492 3.1e-02
tuberculosis 1.200 5.7e-06
ulcerative colitis 1.900 3.6e-03

Synonym

Accession Q6JBY9 B1AK48 Q4G0E7 Q6IN93 Q8IZM2 Q96DX0 Q9NST4
Symbols MK2S4
CAPZIP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSLPLFPPKVDLGQNGEEKSPP      1 - 70
NASHPPKFKVKSSPLIEKLQANLTFDPAALLPGASPKSPGLKAMVSPFHSPPSTPSSPGVRSRPSEAEEV     71 - 140
PVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSDCGELGDFRAVESSQQNGAKEEDGDEVLPSK    141 - 210
SKAPGSPLSSEGAAGEGVRTLGPAEKPPLRRSPSRTEKQEEDRATEEAKNGEKARRSSEEVDGQHPAQEE    211 - 280
VPESPQTSGPEAENRCGSPREEKPAGEEAEMEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPH    281 - 350
SPPGGVKGGDVPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM        351 - 416
//

Text Mined References (14)

PMID Year Title