Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.72
PubTator Score 1.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 1.200 7.3e-07
ependymoma 1.800 1.2e-02
group 3 medulloblastoma 1.300 6.4e-03
intraductal papillary-mucinous adenoma (... 1.600 3.5e-03
intraductal papillary-mucinous carcinoma... 1.300 8.7e-03
intraductal papillary-mucinous neoplasm ... 1.500 8.5e-03
oligodendroglioma 1.400 6.6e-03
osteosarcoma -2.055 1.1e-04
ovarian cancer -1.900 6.5e-06
Pick disease -1.600 1.5e-05
progressive supranuclear palsy -1.200 4.0e-02

Gene RIF (2)

AA Sequence

MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKHGYNVEQALGMLFWHKH      1 - 70
NIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKTIASLVKYYYSWKKTRSRTSLM     71 - 140
DRQARKLANRHNQGDSDDDVEETHPMDGNDSDYDPKKEAKKEGNTEQPVQTSKIGLGRREYQSLQHRHHS    141 - 210
QRSKCRPPKGMYLTQEDVVAVSCSPNAANTILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPP    211 - 280
ESNQKINARWTTEEQLLAVQGVRKYGKDFQAIADVIGNKTVGQVKNFFVNYRRRFNLEEVLQEWEAEQGT    281 - 350
QASNGDASTLGEETKSASNVPSGKSTDEEEEAQTPQAPRTLGPSPPAPSSTPTPTAPIATLNQPPPLLRP    351 - 420
TLPAAPALHRQPPPLQQQARFIQPRPTLNQPPPPLIRPANSMPPRLNPRPVLSTVGGQQPPSLIGIQTDS    421 - 490
QSSLH                                                                     491 - 495
//

Text Mined References (22)

PMID Year Title