Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.11
PubTator Score 1.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease -1.017 3.6e-02
Breast cancer 1.200 2.7e-08
interstitial lung disease 1.200 2.8e-03
intraductal papillary-mucinous neoplasm ... -1.100 5.0e-03
non-small cell lung cancer 1.191 8.6e-10
osteosarcoma 1.545 2.1e-02
ovarian cancer 1.300 6.4e-03
pancreatic cancer 1.500 1.2e-02
primary pancreatic ductal adenocarcinoma 1.722 5.0e-03

Gene RIF (2)

AA Sequence

MMWRPSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQ      1 - 70
LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRN     71 - 140
ATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLE    141 - 210
DLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLV    211 - 280
EANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL                          281 - 328
//

Text Mined References (12)

PMID Year Title