Property Summary

NCBI Gene PubMed Count 18
PubMed Score 16.80
PubTator Score 22.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 3.600 2.5e-02
group 4 medulloblastoma 1.100 8.5e-04
intraductal papillary-mucinous carcinoma... 1.200 3.5e-02
lung adenocarcinoma 1.287 5.2e-05
lung cancer 2.100 9.2e-05
Multiple myeloma 1.699 1.7e-03
nasopharyngeal carcinoma 1.100 1.1e-03
osteosarcoma 2.398 8.9e-05
ovarian cancer 2.800 5.6e-06
Parkinson's disease -1.500 1.6e-03
pituitary cancer -1.100 1.4e-06

Gene RIF (5)

AA Sequence

MRLGPRTAALGLLLLCAAAAGAGKAEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAII      1 - 70
KKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNSDDTVTWDEYNIQMYDRVIDFDENTALD     71 - 140
DAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFVIQEALEEHDKNGDGFVSLEE    141 - 210
FLGDYRWDPTANEDPEWILVEKDRFVNDYDKDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGD    211 - 280
KKLSEEEILENPDLFLTSEATDYGRQLHDDYFYHDEL                                     281 - 317
//

Text Mined References (22)

PMID Year Title