Property Summary

NCBI Gene PubMed Count 21
PubMed Score 182.72
PubTator Score 81.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.226 2.1e-03
astrocytoma 1.200 5.7e-21
Astrocytoma, Pilocytic 1.100 4.3e-04
atypical teratoid/rhabdoid tumor 1.300 1.5e-05
Barrett's esophagus 1.400 2.4e-02
ependymoma 1.400 8.4e-11
esophageal adenocarcinoma 2.200 1.8e-02
gastric carcinoma 1.500 1.4e-02
glioblastoma 1.100 7.6e-06
juvenile dermatomyositis 1.379 1.2e-12
lung cancer 1.300 5.1e-04
medulloblastoma, large-cell 1.100 1.4e-03
Multiple myeloma 1.071 3.6e-03
nasopharyngeal carcinoma 1.700 1.8e-07
oligodendroglioma 1.300 7.9e-16
ovarian cancer 1.300 4.5e-03
pancreatic cancer 1.300 4.5e-03
pediatric high grade glioma 1.200 1.1e-04
pituitary cancer -1.500 4.8e-06
primary pancreatic ductal adenocarcinoma 1.148 3.0e-03
sonic hedgehog group medulloblastoma 1.500 2.9e-04
tuberculosis 1.200 1.8e-06

Gene RIF (12)

AA Sequence

MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK      1 - 70
TFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEY     71 - 140
KQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLE    141 - 210
TLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDH    211 - 280
AQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL                       281 - 331
//

Text Mined References (28)

PMID Year Title