Property Summary

NCBI Gene PubMed Count 20
PubMed Score 182.34
PubTator Score 81.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.071 3.6e-03
Barrett's esophagus 1.400 2.4e-02
esophageal adenocarcinoma 2.200 1.8e-02
astrocytoma 1.300 1.7e-02
glioblastoma multiforme 1.400 3.2e-20
oligodendroglioma 1.300 7.9e-16
posterior fossa group A ependymoma 1.600 8.4e-10
medulloblastoma, large-cell 1.100 1.4e-03
juvenile dermatomyositis 1.379 1.2e-12
tuberculosis 1.200 1.8e-06
primary pancreatic ductal adenocarcinoma 1.148 3.0e-03
lung cancer 1.800 1.9e-05
active Crohn's disease 1.226 2.1e-03
pediatric high grade glioma 1.200 1.1e-04
atypical teratoid/rhabdoid tumor 1.300 1.5e-05
pilocytic astrocytoma 1.100 6.3e-04
sonic hedgehog group medulloblastoma 1.500 2.9e-04
nasopharyngeal carcinoma 1.700 1.8e-07
gastric carcinoma 1.500 1.4e-02
ovarian cancer 1.300 4.5e-03
pituitary cancer -1.500 4.8e-06
pancreatic cancer 1.300 4.5e-03

Gene RIF (10)

PMID Text
27468573 RCN1 expression was not statistically significantly different to healthy controls but was associated with disease activity score and could be used as a stratification biomarker for systemic sclerosis patients.
25242635 reticulocalbin-1 plays a key role in the development of doxorubicin-associated resistance
24451493 Ca(2+) binding caused an increase in the alpha-helix content of human RCN1. On the other hand, RCN1 did not change the structure with Mg.
23916412 a promising role of RCN1 as a possible marker in Renal cell carcinoma
22190034 HIV-1 Pol is identified to have a physical interaction with reticulocalbin 1, EF-hand calcium binding domain (RCN1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21272564 reticulocalbin-1 may be an important molecule in understanding lymphatic endothelial cells in tumors function and control of lymphatic metastasis.
20724591 Increased RCN1 is associated with systemic sclerosis and nephrogenic systemic fibrosis.
19474196 deletion of Rcn1 directly or indirectly contributes to the eye phenotype in Pax6 contiguous gene deletions
18688696 Data show that calumenin in the presence of calcium binds specifically to thrombospondin-1, but closely-related reticulocalbin does not form a similar complex.
18561328 RCN1 also is expressed on the cell surface of several endothelial cell lines, including human dermal microvascular endothelial cells (HDMVECs), bone marrow endothelial cells (BMEC), and transformed human bone marrow endothelial cells (TrHBMEC).

AA Sequence

MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK      1 - 70
TFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEY     71 - 140
KQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLE    141 - 210
TLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDH    211 - 280
AQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL                       281 - 331
//

Text Mined References (27)

PMID Year Title
27468573 2016 Circulating Reticulocalbin 1 and Reticulocalbin 3 in Systemic Sclerosis Patients: Results of a Case Control Study.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25242635 2014 Identification of up- and down-regulated proteins in doxorubicin-resistant uterine cancer cells: reticulocalbin-1 plays a key role in the development of doxorubicin-associated resistance.
24451493 2014 Calcium-dependent structural changes in human reticulocalbin-1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23916412 2013 Proteomic identification of Reticulocalbin 1 as potential tumor marker in renal cell carcinoma.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
21272564 2011 Limited expression of reticulocalbin-1 in lymphatic endothelial cells in lung tumor but not in normal lung.
21269460 2011 Initial characterization of the human central proteome.
20724591 2010 Proteomic analysis identification of a pattern of shared alterations in the secretome of dermal fibroblasts from systemic sclerosis and nephrogenic systemic fibrosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19474196 2009 Analysis of Pax6 contiguous gene deletions in the mouse, Mus musculus, identifies regions distinct from Pax6 responsible for extreme small-eye and belly-spotting phenotypes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18688696 2009 Calumenin but not reticulocalbin forms a Ca2+-dependent complex with thrombospondin-1. A potential role in haemostasis and thrombosis.
18561328 2008 Novel surface expression of reticulocalbin 1 on bone endothelial cells and human prostate cancer cells is regulated by TNF-alpha.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9192846 1997 The reticulocalbin gene maps to the WAGR region in human and to the Small eye Harwell deletion in mouse.
8586628 1995 Cloning of a human homologue of mouse reticulocalbin reveals conservation of structural domains in the novel endoplasmic reticulum resident Ca(2+)-binding protein with multiple EF-hand motifs.
8416973 1993 Reticulocalbin, a novel endoplasmic reticulum resident Ca(2+)-binding protein with multiple EF-hand motifs and a carboxyl-terminal HDEL sequence.