Property Summary

NCBI Gene PubMed Count 19
PubMed Score 69.82
PubTator Score 5.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.0e-06
glioblastoma 1.400 4.6e-05
malignant mesothelioma 1.200 1.9e-06
medulloblastoma 1.100 1.5e-05
medulloblastoma, large-cell 1.700 3.0e-05
osteosarcoma -1.420 5.9e-06
pancreatic ductal adenocarcinoma liver m... -2.396 2.3e-03
posterior fossa group B ependymoma 1.200 5.7e-09

 GO Function (1)

 GO Component (2)

Protein-protein Interaction (9)

Gene RIF (1)

AA Sequence

MATQAHSLSYAGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTG      1 - 70
TTLYYQPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLL     71 - 140
KQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDPGKIKRIRGMAYSVRVSPQMANRIVD    141 - 210
SARSILNKFIPDIYIYTDHMKGVNSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCA    211 - 280
RLLLEEIYRGGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEEL    281 - 350
KGGDKVLMTCVGIGFSNLSKTLK                                                   351 - 373
//

Text Mined References (21)

PMID Year Title