Property Summary

Ligand Count 8
NCBI Gene PubMed Count 14
PubMed Score 71.82
PubTator Score 30.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.2e-06
psoriasis 6694 1.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Follicular mucinosis 4 4.033 2.0
Phaeohyphomycosis 9 3.982 2.0
Progeria 25 3.139 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 1.2e-06
psoriasis -1.300 1.6e-04

Gene RIF (5)

AA Sequence

MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKR      1 - 70
RFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPC     71 - 140
DLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFH    141 - 210
HIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQ    211 - 280
RRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS                         281 - 329
//

Text Mined References (16)

PMID Year Title